From AureoWiki
Jump to navigation Jump to search
Pangenome04-0298108BA0217611819-97685071193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40

NCBI: 10-JUN-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_0079 [new locus tag: SAUSA300_RS00400 ]
  • pan locus tag?: SAUPAN000629000
  • symbol: SAUSA300_0079
  • pan gene symbol?:
  • synonym:
  • product: putative lipoprotein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAUSA300_0079 [new locus tag: SAUSA300_RS00400 ]
  • symbol: SAUSA300_0079
  • product: putative lipoprotein
  • replicon: chromosome
  • strand: +
  • coordinates: 88136..88681
  • length: 546
  • essential: unknown

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    ATGATTAAAAAATTATTTTTTATGATATTAGGATCATTACTAATATTATCAGCTTGCTCC
    AATAATGATGAAAAAGATAAAGACACTAATGACCAAAAAAGTGAGAGCCATATGAAGCAT
    AATGATGAAAGTAAAGTTCCAGAAGATATGAAATCGACTAATGAGGGTGAATTTAAAGTG
    GGAGATAAAGTAACGATTACAGCAGGGCATATGCCAGGTATGAAAGGTGCAGAAGCTACT
    GTAAAAGGTGCGTATAAAACATATGCCTATGTTGTAAGTTATAAACCCACAAATGGAAAT
    GAAAAAGTAAACAATCATAAATGGGTCGTAAACGAAGAGATTAAAGATGCACCTAAAGAT
    GGATTTAGTAAGGGCGATACTGTTAAATTAGAAGCAAGTCATATGTCTGGTATGAAAGGT
    GCTACAGCCAATATAGATAACGTGAAAAAGACTACTGTTTACGTAGTTGATTACAAATCC
    AAAGATAATGGTAAAATCATTAAAAATCATAAATGGATGACAGGAAATGAGCTGAAAGCA
    CGATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    546

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SAUSA300_0079 [new locus tag: SAUSA300_RS00400 ]
  • symbol: SAUSA300_0079
  • description: putative lipoprotein
  • length: 181
  • theoretical pI: 9.60078
  • theoretical MW: 20135.8
  • GRAVY: -0.817127

Function[edit | edit source]

  • TIGRFAM:
    Cellular processes Cellular processes Sporulation and germination sporulation lipoprotein, YhcN/YlaJ family (TIGR02898; HMM-score: 33.8)
    and 2 more
    NusG family protein (TIGR01956; HMM-score: 20.4)
    Genetic information processing Transcription Transcription factors transcription elongation factor/antiterminator RfaH (TIGR01955; HMM-score: 19.8)
  • TheSEED:  
    DUF1541 domain-containing protein
  • PFAM:
    no clan defined DUF1541; Protein of unknown function (DUF1541) (PF07563; HMM-score: 159.7)
    and 2 more
    ETAP (CL0610) NHase_beta; Nitrile hydratase beta subunit (PF02211; HMM-score: 12.7)
    no clan defined DUF3221; Protein of unknown function (DUF3221) (PF11518; HMM-score: 8.2)

Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 3.33
    • Cellwall Score: 3.33
    • Extracellular Score: 3.33
    • Internal Helices: 0
  • LocateP: Lipid anchored
    • Prediction by SwissProt Classification: Extracellular
    • Pathway Prediction: Sec-(SPII)
    • Intracellular possibility: 0
    • Signal peptide possibility: 0.5
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: ILSACSN
  • SignalP: Signal peptide LIPO(Sec/SPII) length 18 aa
    • SP(Sec/SPI): 0.000364
    • TAT(Tat/SPI): 0.000068
    • LIPO(Sec/SPII): 0.999325
    • Cleavage Site: CS pos: 18-19. LSA-CS. Pr: 0.9999
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MIKKLFFMILGSLLILSACSNNDEKDKDTNDQKSESHMKHNDESKVPEDMKSTNEGEFKVGDKVTITAGHMPGMKGAEATVKGAYKTYAYVVSYKPTNGNEKVNNHKWVVNEEIKDAPKDGFSKGDTVKLEASHMSGMKGATANIDNVKKTTVYVVDYKSKDNGKIIKNHKWMTGNELKAR

Experimental data[edit | edit source]

  • experimentally validated: no data available

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]