From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_0253 [new locus tag: SAUSA300_RS01350 ]
  • pan locus tag?: SAUPAN001138000
  • symbol: scdA
  • pan gene symbol?: scdA
  • synonym:
  • product: cell wall biosynthesis protein ScdA

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAUSA300_0253 [new locus tag: SAUSA300_RS01350 ]
  • symbol: scdA
  • product: cell wall biosynthesis protein ScdA
  • replicon: chromosome
  • strand: +
  • coordinates: 305180..305854
  • length: 675
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    ATGATAAATAAAAATGACATAGTAGCAGATGTAGTAACTGATTATCCGAAAGCAGCGGAT
    ATTTTTAGAAGTGTGGGAATAGATTTTTGTTGTGGCGGACAAGTAAGTATAGAAGCAGCA
    GCCTTAGAAAAGAAAAATGTAGATTTGAACGAATTATTACAGCGTCTCAACGACGTTGAA
    CAAACGAATACACCAGGTTCGTTAAATCCTAAATTTTTAAATGTTTCATCACTTATTCAA
    TATATTCAATCAGCATATCATGAACCTCTAAGAGAAGAATTTAAAAATTTAACACCTTAT
    GTGACGAAGTTATCGAAAGTACATGGACCTAATCATCCATATTTAGTTGAGTTAAAAGAA
    ACATACGATACATTTAAAAATGGCATGTTAGAGCATATGCAAAAAGAAGACGATGTCGAT
    TTTCCAAAACTCATTAAATATGAGCAAGGTGAGGTAGTAGACGATATTAATACTGTGATA
    GATGATTTAGTTTCAGACCACATTGCAACGGGAGAATTGTTAGTAAAAATGAGCGAATTA
    ACATCTAGTTATGAACCTCCGATAGAAGCGTGTGGTACTTGGCGACTTGTTTATCAGAGA
    TTAAAAGCACTTGAAGTGTTAACACATGAACACGTACATTTAGAGAATCACGTATTATTT
    AAAAAAGTATCATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    675

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SAUSA300_0253 [new locus tag: SAUSA300_RS01350 ]
  • symbol: ScdA
  • description: cell wall biosynthesis protein ScdA
  • length: 224
  • theoretical pI: 4.79982
  • theoretical MW: 25484.8
  • GRAVY: -0.326786

Function[edit | edit source]

  • TIGRFAM:
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Other iron-sulfur cluster repair di-iron protein (TIGR03652; HMM-score: 256)
    and 2 more
    Metabolism Energy metabolism Electron transport hybrid cluster protein-associated redox disulfide domain (TIGR03980; HMM-score: 18.1)
    Metabolism Fatty acid and phospholipid metabolism Biosynthesis poly(R)-hydroxyalkanoic acid synthase, class III, PhaC subunit (TIGR01836; HMM-score: 13.5)
  • TheSEED:  
    Nitrogen Metabolism Nitrogen Metabolism - no subcategory Nitrosative stress  Nitric oxide-dependent regulator DnrN or NorA
    and 1 more
    Stress Response Stress Response - no subcategory Flavohaemoglobin  Nitric oxide-dependent regulator DnrN or NorA
  • PFAM:
    no clan defined ScdA_N; Domain of Unknown function (DUF542) (PF04405; HMM-score: 75.4)
    Hemerythrin; Hemerythrin HHE cation binding domain (PF01814; HMM-score: 71.1)
    and 1 more
    DUF1858; Domain of unknown function (DUF1858) (PF08984; HMM-score: 23.9)

Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.018884
    • TAT(Tat/SPI): 0.000992
    • LIPO(Sec/SPII): 0.004088
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MINKNDIVADVVTDYPKAADIFRSVGIDFCCGGQVSIEAAALEKKNVDLNELLQRLNDVEQTNTPGSLNPKFLNVSSLIQYIQSAYHEPLREEFKNLTPYVTKLSKVHGPNHPYLVELKETYDTFKNGMLEHMQKEDDVDFPKLIKYEQGEVVDDINTVIDDLVSDHIATGELLVKMSELTSSYEPPIEACGTWRLVYQRLKALEVLTHEHVHLENHVLFKKVS

Experimental data[edit | edit source]

  • experimentally validated: no data available

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

  • scdA no polycistronic organisation predicted

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]