Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus USA300_FPR3757
- locus tag: SAUSA300_0851 [new locus tag: SAUSA300_RS04595 ]
- pan locus tag?: SAUPAN003049000
- symbol: mnhE
- pan gene symbol?: mnhE1
- synonym:
- product: putative monovalent cation/H+ antiporter subunit E
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAUSA300_0851 [new locus tag: SAUSA300_RS04595 ]
- symbol: mnhE
- product: putative monovalent cation/H+ antiporter subunit E
- replicon: chromosome
- strand: -
- coordinates: 928957..929436
- length: 480
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3914731 NCBI
- RefSeq: YP_493551 NCBI
- BioCyc: see SAUSA300_RS04595
- MicrobesOnline: 1292366 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421ATGGCTGTACAATTAGTATTAAACTTTATTATCGCAGTGTTTTGGTTGTTTGTGACAAAT
AGTTACACAACAAATAACTTTGTGTTAGGTTTCATCTTTGGCCTAGTTCTTGTTTACCTC
TTACACAGAGTGTTACCAGGTAGATTTTATGTCATCACGCTATATCGTATTATTAAATTA
GTTATTATTTTCTTAATCGAACTGATTAAAGCTAATTTTGATGTTTTGAAAATTATTATT
AAACCTTCGATTAAAAATGAACCAGGATTCTTTGTTTATCACACAGATTTAAAAAAAGAT
TGGCAAATTGTCTTGCTGTCTAATTTAATTACATTAACACCTGGTACTGTAGTGCTTGGT
GTAAGTGACGATCGTACAAAAATTTATATTCATGCCATAGATTTTTCAACTAAAGAGCAA
GAAGTAGAAAGTATTAAAACATCATTAGAGAAAATTGTAAGAGAGGTGGGCGAAATATAA60
120
180
240
300
360
420
480
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAUSA300_0851 [new locus tag: SAUSA300_RS04595 ]
- symbol: MnhE
- description: putative monovalent cation/H+ antiporter subunit E
- length: 159
- theoretical pI: 9.30363
- theoretical MW: 18318.7
- GRAVY: 0.693082
⊟Function[edit | edit source]
- TIGRFAM: Transport and binding proteins Cations and iron carrying compounds multicomponent Na+:H+ antiporter (TIGR00942; HMM-score: 231.1)
- TheSEED :
- Na(+) H(+) antiporter subunit E (TC 2.A.63.1.3)
- PFAM: no clan defined MNHE; Na+/H+ ion antiporter subunit (PF01899; HMM-score: 145.4)and 1 moreDUF659; Protein of unknown function (DUF 659) (PF04937; HMM-score: 13.9)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0.32
- Cytoplasmic Membrane Score: 9.55
- Cellwall Score: 0.12
- Extracellular Score: 0.01
- Internal Helices: 2
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 0.9998
- Cell wall & surface Score: 0
- Extracellular Score: 0.0002
- LocateP: Multi-transmembrane
- Prediction by SwissProt Classification: Membrane
- Pathway Prediction: Sec-(SPI)
- Intracellular possibility: 0.17
- Signal peptide possibility: -1
- N-terminally Anchored Score: -1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.003764
- TAT(Tat/SPI): 0.000247
- LIPO(Sec/SPII): 0.0758
- predicted transmembrane helices (TMHMM): 4
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MAVQLVLNFIIAVFWLFVTNSYTTNNFVLGFIFGLVLVYLLHRVLPGRFYVITLYRIIKLVIIFLIELIKANFDVLKIIIKPSIKNEPGFFVYHTDLKKDWQIVLLSNLITLTPGTVVLGVSDDRTKIYIHAIDFSTKEQEVESIKTSLEKIVREVGEI
⊟Experimental data[edit | edit source]
- experimentally validated: data available for COL, NCTC8325
- protein localization: data available for COL
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- data available for JSNZ
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
⊟Relevant publications[edit | edit source]
- ↑ Manisha Vaish, Alexa Price-Whelan, Tamara Reyes-Robles, Jun Liu, Amyeo Jereen, Stephanie Christie, Francis Alonzo, Meredith A Benson, Victor J Torres, Terry A Krulwich
Roles of Staphylococcus aureus Mnh1 and Mnh2 Antiporters in Salt Tolerance, Alkali Tolerance, and Pathogenesis.
J Bacteriol: 2018, 200(5);
[PubMed:29263099] [WorldCat.org] [DOI] (I e)