From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_0849 [new locus tag: SAUSA300_RS04585 ]
  • pan locus tag?: SAUPAN003047000
  • symbol: mnhG
  • pan gene symbol?: mnhG1
  • synonym:
  • product: putative monovalent cation/H+ antiporter subunit G

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAUSA300_0849 [new locus tag: SAUSA300_RS04585 ]
  • symbol: mnhG
  • product: putative monovalent cation/H+ antiporter subunit G
  • replicon: chromosome
  • strand: -
  • coordinates: 928330..928686
  • length: 357
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    ATGATCAAAATCATACTGATTAGTCTTGCACTTATCTTTGTTATCATCGGTGCTTTAATT
    AGCGCCCTAGCAGCTATAGGATTATTGAGACTTGAAGATGTATATTCACGTGCACATGCT
    GCCGGAAAAGCATCAACATTAGGTGCAATGTCATTACTATTTGGTACGTTTTTATATTTT
    ATTGCTACTCAAGGTTTTGTAAATATGCAATTAATCGTTGCGATTATCTTTGTATTAATT
    ACAGGTCCTCTTTCAAGTCATATGATTATGAAAGCAGCATATAATATTAAAACGCCTTAT
    ACTAAAAAGACTAAAGTCGATGAAATTTCGGAAGACTTAAAAGACACAAAATTGTAG
    60
    120
    180
    240
    300
    357

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SAUSA300_0849 [new locus tag: SAUSA300_RS04585 ]
  • symbol: MnhG
  • description: putative monovalent cation/H+ antiporter subunit G
  • length: 118
  • theoretical pI: 10.0063
  • theoretical MW: 12818.4
  • GRAVY: 0.894915

Function[edit | edit source]

  • TIGRFAM:
    Metabolism Transport and binding proteins Cations and iron carrying compounds monovalent cation/proton antiporter, MnhG/PhaG subunit (TIGR01300; HMM-score: 87.9)
  • TheSEED  :
    • Na(+) H(+) antiporter subunit G (TC 2.A.63.1.3)
    Membrane Transport Uni- Sym- and Antiporters Sodium Hydrogen Antiporter  Na(+) H(+) antiporter subunit G (TC 2.A.63.1.3)
  • PFAM:
    no clan defined PhaG_MnhG_YufB; Na+/H+ antiporter subunit (PF03334; HMM-score: 88.7)
    and 4 more
    Phage_holin_6_1; Bacteriophage holin of superfamily 6 (Holin_LLH) (PF09682; HMM-score: 9.3)
    YtpI; YtpI-like protein (PF14007; HMM-score: 8.6)
    Sigma_reg_N; Sigma factor regulator N-terminal (PF13800; HMM-score: 7.2)
    Tetraspannin (CL0347) Tetraspannin; Tetraspanin family (PF00335; HMM-score: 6.3)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 10
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 3
  • LocateP: Multi-transmembrane
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular possibility: 0.17
    • Signal peptide possibility: 0.5
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.04049
    • TAT(Tat/SPI): 0.001137
    • LIPO(Sec/SPII): 0.042421
  • predicted transmembrane helices (TMHMM): 3

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MIKIILISLALIFVIIGALISALAAIGLLRLEDVYSRAHAAGKASTLGAMSLLFGTFLYFIATQGFVNMQLIVAIIFVLITGPLSSHMIMKAAYNIKTPYTKKTKVDEISEDLKDTKL

Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]

[1]

  1. Manisha Vaish, Alexa Price-Whelan, Tamara Reyes-Robles, Jun Liu, Amyeo Jereen, Stephanie Christie, Francis Alonzo, Meredith A Benson, Victor J Torres, Terry A Krulwich
    Roles of Staphylococcus aureus Mnh1 and Mnh2 Antiporters in Salt Tolerance, Alkali Tolerance, and Pathogenesis.
    J Bacteriol: 2018, 200(5);
    [PubMed:29263099] [WorldCat.org] [DOI] (I e)