Jump to navigation
Jump to search
NCBI: 06-JUL-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus Newman
- locus tag: NWMN_0816 [new locus tag: NWMN_RS04615 ]
- pan locus tag?: SAUPAN003047000
- symbol: mnhG
- pan gene symbol?: mnhG1
- synonym:
- product: putative monovalent cation/H+ antiporter subunit G
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: NWMN_0816 [new locus tag: NWMN_RS04615 ]
- symbol: mnhG
- product: putative monovalent cation/H+ antiporter subunit G
- replicon: chromosome
- strand: -
- coordinates: 904977..905333
- length: 357
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 5330484 NCBI
- RefSeq: YP_001331850 NCBI
- BioCyc:
- MicrobesOnline: 3706365 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGATCAAAATCATACTGATTAGTCTTGCACTTATCTTTGTTATCATCGGTGCTTTAATT
AGCGCCCTAGCAGCTATAGGATTATTGAGACTTGAAGATGTATATTCACGTGCACATGCT
GCCGGAAAAGCATCAACATTAGGTGCAATGTCATTACTATTTGGTACGTTTTTATATTTT
ATTGCTACTCAAGGTTTTGTAAATATGCAATTAATCGTTGCGATTATCTTTGTATTAATT
ACAGGTCCTCTTTCAAGTCATATGATTATGAAAGCAGCATATAATATTAAAACGCCTTAT
ACTAAAAAGACTAAAGTCGATGAAATTTCGGAAGACTTAAAAGACACAAAATTGTAG60
120
180
240
300
357
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: NWMN_0816 [new locus tag: NWMN_RS04615 ]
- symbol: MnhG
- description: putative monovalent cation/H+ antiporter subunit G
- length: 118
- theoretical pI: 10.0063
- theoretical MW: 12818.4
- GRAVY: 0.894915
⊟Function[edit | edit source]
- TIGRFAM: Transport and binding proteins Cations and iron carrying compounds monovalent cation/proton antiporter, MnhG/PhaG subunit (TIGR01300; HMM-score: 87.9)
- TheSEED :
- Na(+) H(+) antiporter subunit G (TC 2.A.63.1.3)
- PFAM: no clan defined PhaG_MnhG_YufB; Na+/H+ antiporter subunit (PF03334; HMM-score: 85.7)and 3 moreCopD_like (CL0430) YtpI; YtpI-like protein (PF14007; HMM-score: 8.4)TSPAN_4TM-like (CL0347) Tetraspanin; Tetraspanin family (PF00335; HMM-score: 8.1)no clan defined DUF6057; Family of unknown function (DUF6057) (PF19529; HMM-score: 7.2)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 10
- Cellwall Score: 0
- Extracellular Score: 0
- Internal Helices: 3
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 0.9983
- Cell wall & surface Score: 0
- Extracellular Score: 0.0017
- LocateP: Multi-transmembrane
- Prediction by SwissProt Classification: Membrane
- Pathway Prediction: Sec-(SPI)
- Intracellular possibility: 0.17
- Signal peptide possibility: 0.5
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.04049
- TAT(Tat/SPI): 0.001137
- LIPO(Sec/SPII): 0.042421
- predicted transmembrane helices (TMHMM): 3
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MIKIILISLALIFVIIGALISALAAIGLLRLEDVYSRAHAAGKASTLGAMSLLFGTFLYFIATQGFVNMQLIVAIIFVLITGPLSSHMIMKAAYNIKTPYTKKTKVDEISEDLKDTKL
⊟Experimental data[edit | edit source]
- experimentally validated: data available for COL, NCTC8325
- protein localization: data available for COL
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- data available for JSNZ
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]