From AureoWiki
Jump to navigation Jump to search

NCBI: 06-JUL-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_0820 [new locus tag: NWMN_RS04635 ]
  • pan locus tag?: SAUPAN003051000
  • symbol: mnhC
  • pan gene symbol?: mnhC
  • synonym:
  • product: putative monovalent cation/H+ antiporter subunit C

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: NWMN_0820 [new locus tag: NWMN_RS04635 ]
  • symbol: mnhC
  • product: putative monovalent cation/H+ antiporter subunit C
  • replicon: chromosome
  • strand: -
  • coordinates: 907574..907972
  • length: 399
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    ATGTGCAGTAGTTGGTACTGTCATGACAATTATTATTTCGATTGGAGAGAACGAATAGTG
    GAAATTATTATGATTTTTGTTAGTGGTATTCTCACAGCAATTAGTGTCTATCTCGTTTTG
    TCTAAAAGTCTGATACGAATTGTTATGGGAACTACACTATTAACACATGCAGCAAATTTA
    TTTTTAATAACTATGGGCGGACTTAAACATGGTACTGTTCCAATTTATGAAGCGAACGTA
    AAAAGCTATGTTGATCCTATCCCGCAAGCACTTATTTTAACAGCAATCGTTATCGCCTTT
    GCGACAACAGCCTTTTTCTTAGTATTAGCATTTAGAACATATAAAGAATTAGGCACAGAT
    AACGTTGAGAGTATGAAAGGAGTTCCAGAAGATGATTGA
    60
    120
    180
    240
    300
    360
    399

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: NWMN_0820 [new locus tag: NWMN_RS04635 ]
  • symbol: MnhC
  • description: putative monovalent cation/H+ antiporter subunit C
  • length: 132
  • theoretical pI: 5.57988
  • theoretical MW: 14817.3
  • GRAVY: 0.590151

Function[edit | edit source]

  • TIGRFAM:
    Metabolism Transport and binding proteins Cations and iron carrying compounds multicomponent Na+:H+ antiporter, MnhC subunit (TIGR00941; HMM-score: 172.5)
    and 1 more
    cxxc_20_cxxc protein (TIGR04104; HMM-score: 10.6)
  • TheSEED:  
    Membrane Transport Uni- Sym- and Antiporters Sodium Hydrogen Antiporter  Na(+) H(+) antiporter subunit C (TC 2.A.63.1.3)
  • PFAM:
    no clan defined Oxidored_q2; NADH-ubiquinone/plastoquinone oxidoreductase chain 4L (PF00420; HMM-score: 109.9)
    and 1 more
    SPT_ssu-like; Small subunit of serine palmitoyltransferase-like (PF11779; HMM-score: 11.3)

Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.32
    • Cytoplasmic Membrane Score: 9.55
    • Cellwall Score: 0.12
    • Extracellular Score: 0.01
    • Internal Helices: 2
  • LocateP: Multi-transmembrane
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular possibility: 0.17
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.003375
    • TAT(Tat/SPI): 0.000097
    • LIPO(Sec/SPII): 0.002195
  • predicted transmembrane helices (TMHMM): 3

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MCSSWYCHDNYYFDWRERIVEIIMIFVSGILTAISVYLVLSKSLIRIVMGTTLLTHAANLFLITMGGLKHGTVPIYEANVKSYVDPIPQALILTAIVIAFATTAFFLVLAFRTYKELGTDNVESMKGVPEDD

Experimental data[edit | edit source]

  • experimentally validated: no data available

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]