From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_0858 [new locus tag: SAUSA300_RS04630 ]
  • pan locus tag?: SAUPAN003057000
  • symbol: SAUSA300_0858
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAUSA300_0858 [new locus tag: SAUSA300_RS04630 ]
  • symbol: SAUSA300_0858
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 935714..936058
  • length: 345
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    GTGCGTGTAACTGGTATTCAACCATACGGTGCGTTTGTTGAGACCCCTAATCATACTGAA
    GGACTGATTCATATATCAGAAATTATGGATGACTACGTTCATAATTTGAAGAAATTTCTA
    TCAGAAGGCCAAATTGTTAAAGCTAAAATTTTGTCTATAGATGATGAAGGAAAGCTTAAT
    CTATCATTAAAGGATAATGATTACTTCAAAAATTATGAGCGTAAGAAGGAAAAACAATCA
    GTATTAGATGAAATCAGAGAAACAGAAAAATATGGGTTTCAAACACTTAAAGAACGCTTA
    CCAATCTGGATAAAACAGTCAAAGCGAGCAATTCGAAACGACTAA
    60
    120
    180
    240
    300
    345

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SAUSA300_0858 [new locus tag: SAUSA300_RS04630 ]
  • symbol: SAUSA300_0858
  • description: hypothetical protein
  • length: 114
  • theoretical pI: 8.81649
  • theoretical MW: 13427.2
  • GRAVY: -0.791228

Function[edit | edit source]

  • TIGRFAM:
    Genetic information processing Transcription Degradation of RNA polyribonucleotide nucleotidyltransferase (TIGR03591; EC 2.7.7.8; HMM-score: 52.7)
    Genetic information processing Protein synthesis Ribosomal proteins: synthesis and modification ribosomal protein bS1 (TIGR00717; HMM-score: 48)
    and 2 more
    Genetic information processing Transcription Degradation of RNA ribonuclease R (TIGR02063; EC 3.1.-.-; HMM-score: 21.8)
    guanosine pentaphosphate synthetase I/polyribonucleotide nucleotidyltransferase (TIGR02696; EC 2.7.-.-,2.7.7.8; HMM-score: 20.8)
  • TheSEED  :
    • General stress protein 13
  • PFAM:
    OB (CL0021) S1; S1 RNA binding domain (PF00575; HMM-score: 48.1)
    and 6 more
    S1_RRP5; RRP5 S1 domain (PF23459; HMM-score: 28.7)
    OB_RRP5_4th; RRP5 OB-fold domain (PF24685; HMM-score: 22.3)
    Spt6_S1; Spt6, S1/OB domain (PF21710; HMM-score: 19.9)
    no clan defined UAE_UbL; Ubiquitin/SUMO-activating enzyme ubiquitin-like domain (PF14732; HMM-score: 17.5)
    OB (CL0021) CvfB_2nd; Virulence regulatory factor CvfB, second domain (PF21543; HMM-score: 17.2)
    SH3 (CL0010) BPL_C; Biotin protein ligase C terminal domain (PF02237; HMM-score: 13.2)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9638
    • Cytoplasmic Membrane Score: 0.0354
    • Cell wall & surface Score: 0.0001
    • Extracellular Score: 0.0007
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.002761
    • TAT(Tat/SPI): 0.00014
    • LIPO(Sec/SPII): 0.000299
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MRVTGIQPYGAFVETPNHTEGLIHISEIMDDYVHNLKKFLSEGQIVKAKILSIDDEGKLNLSLKDNDYFKNYERKKEKQSVLDEIRETEKYGFQTLKERLPIWIKQSKRAIRND

Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]