Jump to navigation
Jump to search
NCBI: 26-AUG-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus N315
- locus tag: SA0816
- pan locus tag?: SAUPAN003057000
- symbol: SA0816
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SA0816
- symbol: SA0816
- product: hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 919833..920093
- length: 261
- essential: no DEG other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 1123631 NCBI
- RefSeq: NP_374077 NCBI
- BioCyc:
- MicrobesOnline: 103103 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241ATGGATGACTACGTTCATAATTTGAAGAAATTTCTATCAGAAGGCCAAATTGTTAAAGCT
AAAATTTTGTCTATAGATGATGAAGGAAAGCTTAATCTATCATTAAAGGATAATGATTAC
TTCAAAAATTATGAGCGTAAGAAGGAAAAACAATCAGTATTAGATGAAATCAGAGAAACA
GAAAAATATGGGTTTCAAACACTTAAAGAACGCTTACCAATCTGGATAAAACAGTCAAAG
CGAGCAATTCGAAACGACTAA60
120
180
240
261
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SA0816
- symbol: SA0816
- description: hypothetical protein
- length: 86
- theoretical pI: 9.67536
- theoretical MW: 10334.7
- GRAVY: -1.04535
⊟Function[edit | edit source]
- TIGRFAM: Transcription Degradation of RNA polyribonucleotide nucleotidyltransferase (TIGR03591; EC 2.7.7.8; HMM-score: 16)Protein synthesis Ribosomal proteins: synthesis and modification ribosomal protein bS1 (TIGR00717; HMM-score: 15.2)
- TheSEED :
- General stress protein 13
- PFAM: OB (CL0021) CvfB_2nd; Virulence regulatory factor CvfB, second domain (PF21543; HMM-score: 15.2)SH3 (CL0010) BPL_C; Biotin protein ligase C terminal domain (PF02237; HMM-score: 13.1)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9522
- Cytoplasmic Membrane Score: 0.0308
- Cell wall & surface Score: 0.0004
- Extracellular Score: 0.0166
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.001756
- TAT(Tat/SPI): 0.000179
- LIPO(Sec/SPII): 0.000427
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MDDYVHNLKKFLSEGQIVKAKILSIDDEGKLNLSLKDNDYFKNYERKKEKQSVLDEIRETEKYGFQTLKERLPIWIKQSKRAIRND
⊟Experimental data[edit | edit source]
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: no polycistronic organisation predicted
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]