Jump to navigation
Jump to search
NCBI: 01-DEC-2025
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus JSNZ
- locus tag: EGJ38_000918 [new locus tag: EGJ38_RS04585 ]
- pan locus tag?: SAUPAN003057000
- symbol: ygs
- pan gene symbol?: —
- synonym:
- alternate name: JSNZ_000918
- product: S1 domain-containing post-transcriptional regulator Ygs
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: EGJ38_000918 [new locus tag: EGJ38_RS04585 ]
- symbol: ygs
- product: S1 domain-containing post-transcriptional regulator Ygs
- replicon: chromosome
- strand: +
- coordinates: 913589..913966
- length: 378
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID:
- RefSeq: MGT2422890 NCBI
- BioCyc:
- MicrobesOnline:
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361TTGAATAACTACAAAATTGGCCAACATATCAAGGTGCGTGTAACTGGTATTCAACCATAC
GGTGCGTTTGTTGAGACCCCTAATCATACTGAAGGACTGATTCATATATCAGAAATTATG
GATGACTACGTTCATAATTTGAAGAAATTTCTATCAGAAGGCCAAATTGTTAAAGCTAAA
ATTTTGTCTATAGATGATGAAGGAAAGCTTAATCTATCATTAAAGGATAATGATTACTTC
AAAAATTATGAGCGTAAGAAGGAAAAACAATCAGTATTAGATGAAATCAGAGAAACAGAA
AAATATGGGTTTCAAACACTTAAAGAACGCTTACCAATCTGGATAAAACAGTCAAAGCGA
GCAATTCGAAACGACTAA60
120
180
240
300
360
378
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: EGJ38_000918 [new locus tag: EGJ38_RS04585 ]
- symbol: Ygs
- description: S1 domain-containing post-transcriptional regulator Ygs
- length: 125
- theoretical pI: 9.53333
- theoretical MW: 14722.7
- GRAVY: -0.8016
⊟Function[edit | edit source]
- TIGRFAM: Protein synthesis Ribosomal proteins: synthesis and modification ribosomal protein bS1 (TIGR00717; HMM-score: 60.4)Transcription Degradation of RNA polyribonucleotide nucleotidyltransferase (TIGR03591; EC 2.7.7.8; HMM-score: 58.5)and 5 moreTranscription Degradation of RNA ribonuclease R (TIGR02063; EC 3.1.-.-; HMM-score: 30.6)guanosine pentaphosphate synthetase I/polyribonucleotide nucleotidyltransferase (TIGR02696; EC 2.7.-.-,2.7.7.8; HMM-score: 22.4)Transcription Degradation of RNA ribonuclease, Rne/Rng family (TIGR00757; EC 3.1.4.-; HMM-score: 13.5)Transcription DNA-dependent RNA polymerase DNA-directed RNA polymerase (TIGR00448; EC 2.7.7.6; HMM-score: 13.2)Transcription Degradation of RNA VacB and RNase II family 3'-5' exoribonucleases (TIGR00358; EC 3.1.13.1; HMM-score: 13)
- TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
- PFAM: OB (CL0021) S1; S1 RNA binding domain (PF00575; HMM-score: 53.6)and 7 moreS1_RRP5; RRP5 S1 domain (PF23459; HMM-score: 33.4)OB_RRP5_4th; RRP5 OB-fold domain (PF24685; HMM-score: 31.6)CvfB_2nd; Virulence regulatory factor CvfB, second domain (PF21543; HMM-score: 22.9)Spt6_S1; Spt6, S1/OB domain (PF21710; HMM-score: 22.9)no clan defined UAE_UbL; Ubiquitin/SUMO-activating enzyme ubiquitin-like domain (PF14732; HMM-score: 17.3)SH3 (CL0010) BPL_C; Biotin protein ligase C terminal domain (PF02237; HMM-score: 16.1)OB (CL0021) S1_2; S1 domain (PF13509; HMM-score: 12.9)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 9.97
- Cytoplasmic Membrane Score: 0
- Cellwall Score: 0.01
- Extracellular Score: 0.02
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9585
- Cytoplasmic Membrane Score: 0.0396
- Cell wall & surface Score: 0.0002
- Extracellular Score: 0.0017
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.003807
- TAT(Tat/SPI): 0.000141
- LIPO(Sec/SPII): 0.000505
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: MGT2422890 NCBI
- UniProt:
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MNNYKIGQHIKVRVTGIQPYGAFVETPNHTEGLIHISEIMDDYVHNLKKFLSEGQIVKAKILSIDDEGKLNLSLKDNDYFKNYERKKEKQSVLDEIRETEKYGFQTLKERLPIWIKQSKRAIRND
⊟Experimental data[edit | edit source]
- experimentally validated: data available for COL, NCTC8325
- protein localization: data available for COL
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]