Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL0958 [new locus tag: SACOL_RS04910 ]
- pan locus tag?: SAUPAN003057000
- symbol: SACOL0958
- pan gene symbol?: —
- synonym:
- product: general stress protein 13
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL0958 [new locus tag: SACOL_RS04910 ]
- symbol: SACOL0958
- product: general stress protein 13
- replicon: chromosome
- strand: +
- coordinates: 959155..959532
- length: 378
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3237892 NCBI
- RefSeq: YP_185827 NCBI
- BioCyc: see SACOL_RS04910
- MicrobesOnline: 912428 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361TTGAATAACTACAAAATTGGCCAACATATCAAGGTGCGTGTAACTGGTATTCAACCATAC
GGTGCGTTTGTTGAGACCCCTAATCATACTGAAGGACTGATTCATATATCAGAAATTATG
GATGACTACGTTCATAATTTGAAGAAATTTCTATCAGAAGGCCAAATTGTTAAAGCTAAA
ATTTTGTCTATAGATGATGAAGGAAAGCTTAATCTATCATTAAAGGATAATGATTACTTC
AAAAATTATGAGCGTAAGAAGGAAAAACAATCAGTATTAGATGAAATCAGAGAAACAGAA
AAATATGGGTTTCAAACACTTAAAGAACGCTTACCAATCTGGATAAAACAGTCAAAGCGA
GCAATTCGAAACGACTAA60
120
180
240
300
360
378
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL0958 [new locus tag: SACOL_RS04910 ]
- symbol: SACOL0958
- description: general stress protein 13
- length: 125
- theoretical pI: 9.53333
- theoretical MW: 14722.7
- GRAVY: -0.8016
⊟Function[edit | edit source]
- TIGRFAM: Protein synthesis Ribosomal proteins: synthesis and modification ribosomal protein bS1 (TIGR00717; HMM-score: 60.4)Transcription Degradation of RNA polyribonucleotide nucleotidyltransferase (TIGR03591; EC 2.7.7.8; HMM-score: 58.5)and 5 moreTranscription Degradation of RNA ribonuclease R (TIGR02063; EC 3.1.-.-; HMM-score: 30.6)guanosine pentaphosphate synthetase I/polyribonucleotide nucleotidyltransferase (TIGR02696; EC 2.7.-.-,2.7.7.8; HMM-score: 22.4)Transcription Degradation of RNA ribonuclease, Rne/Rng family (TIGR00757; EC 3.1.4.-; HMM-score: 13.5)Transcription DNA-dependent RNA polymerase DNA-directed RNA polymerase (TIGR00448; EC 2.7.7.6; HMM-score: 13.2)Transcription Degradation of RNA VacB and RNase II family 3'-5' exoribonucleases (TIGR00358; EC 3.1.13.1; HMM-score: 13)
- TheSEED :
- General stress protein 13
- PFAM: OB (CL0021) S1; S1 RNA binding domain (PF00575; HMM-score: 51.8)and 2 moreno clan defined UAE_UbL; Ubiquitin/SUMO-activating enzyme ubiquitin-like domain (PF14732; HMM-score: 18.3)TRB (CL0206) BPL_C; Biotin protein ligase C terminal domain (PF02237; HMM-score: 15.4)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 9.97
- Cytoplasmic Membrane Score: 0
- Cellwall Score: 0.01
- Extracellular Score: 0.02
- Internal Helices: 0
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.003807
- TAT(Tat/SPI): 0.000141
- LIPO(Sec/SPII): 0.000505
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MNNYKIGQHIKVRVTGIQPYGAFVETPNHTEGLIHISEIMDDYVHNLKKFLSEGQIVKAKILSIDDEGKLNLSLKDNDYFKNYERKKEKQSVLDEIRETEKYGFQTLKERLPIWIKQSKRAIRND
⊟Experimental data[edit | edit source]
- experimentally validated: PeptideAtlas
- protein localization: Cytoplasmic [1] [2]
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: no polycistronic organisation predicted
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
PLoS One: 2009, 4(12);e8176
[PubMed:19997597] [WorldCat.org] [DOI] (I e) - ↑ Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
The Staphylococcus aureus proteome.
Int J Med Microbiol: 2014, 304(2);110-20
[PubMed:24439828] [WorldCat.org] [DOI] (I p)