From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_1344 [new locus tag: SAUSA300_RS07330 ]
  • pan locus tag?: SAUPAN003913000
  • symbol: SAUSA300_1344
  • pan gene symbol?: dnaD
  • synonym:
  • product: putative DNA replication protein DnaD

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAUSA300_1344 [new locus tag: SAUSA300_RS07330 ]
  • symbol: SAUSA300_1344
  • product: putative DNA replication protein DnaD
  • replicon: chromosome
  • strand: -
  • coordinates: 1508674..1509360
  • length: 687
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    ATGGATAAATATCAATTAAAAGCAAGACCTGTAGTGATACGAAGAGAATTATTAGACCAT
    TACAGTGACTTAGGTTTAGATGAGCAAGATTTAGTCATTTTGCTTAAATTGATTTATGCT
    TCCGAAACATCAAATAAACAGCCTTCAATTGAATTGCTTCAGAAGGGCTCAACTATGCAA
    CCACGTGATATTACAATGGTTATTCAAAATTTGATACAACGTGAATTGCTAGAATTACAA
    GTTCAAAAAGATGAAGAAGGTAGATTTACCGAATATATGAATCTAGATCCTTTTTTCGAA
    AAATTAAGTCATATATTGAAGCAACAAAGTATGGAAACGAAAGAGCTAAATAGTAAAGAA
    AAATTTAAACAATTATTTAGAGTTTTAGAGGATACATTTGCAAGGCCGTTATCTCCATAT
    GAAATAGAAACGTTAAATCAATGGATTGATGTTGATAAACACGATACTGCAATTATACAA
    GCGGCATTAGACGAGGCGAATAGTTTGAATAAACTTAGCTTTAAATATATAGATCGTATT
    TTACTTAATTGGAAGAAAAACAATGTCAAAACAATTGACGATTCTAGAAAAATAAGAGAA
    AAATTCAATAAACCGAAAATGACGCACACAGTTAAAACGGTACCTAAATTTGATTGGTTA
    AACGGGGAGAACCTTGATGGTAAGTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    687

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SAUSA300_1344 [new locus tag: SAUSA300_RS07330 ]
  • symbol: SAUSA300_1344
  • description: putative DNA replication protein DnaD
  • length: 228
  • theoretical pI: 6.98192
  • theoretical MW: 26954.8
  • GRAVY: -0.657456

Function[edit | edit source]

  • TIGRFAM:
    Genetic information processing DNA metabolism DNA replication, recombination, and repair DnaD domain protein (TIGR01446; HMM-score: 78.3)
    Genetic information processing Mobile and extrachromosomal element functions Prophage functions DnaD domain protein (TIGR01446; HMM-score: 78.3)
    and 2 more
    Genetic information processing DNA metabolism DNA replication, recombination, and repair DnaD family protein (TIGR04548; HMM-score: 39)
    Signal transduction Regulatory functions DNA interactions staphylococcal accessory regulator family (TIGR01889; HMM-score: 10.6)
  • TheSEED:  
    Cell Division and Cell Cycle Cell Division and Cell Cycle - no subcategory Control of cell elongation - division cycle in Bacilli  Chromosome replication initiation protein dnaD
  • PFAM:
    no clan defined DnaB_2; Replication initiation and membrane attachment (PF07261; HMM-score: 76.7)
    and 1 more
    Membr_traf_MHD; Munc13 (mammalian uncoordinated) homology domain (PF10540; HMM-score: 15.2)

Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.002042
    • TAT(Tat/SPI): 0.000433
    • LIPO(Sec/SPII): 0.000278
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MDKYQLKARPVVIRRELLDHYSDLGLDEQDLVILLKLIYASETSNKQPSIELLQKGSTMQPRDITMVIQNLIQRELLELQVQKDEEGRFTEYMNLDPFFEKLSHILKQQSMETKELNSKEKFKQLFRVLEDTFARPLSPYEIETLNQWIDVDKHDTAIIQAALDEANSLNKLSFKYIDRILLNWKKNNVKTIDDSRKIREKFNKPKMTHTVKTVPKFDWLNGENLDGK

Experimental data[edit | edit source]

  • experimentally validated: no data available

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]