Jump to navigation
Jump to search
Pangenome04-0298108BA0217611819-97685071193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus USA300_FPR3757
- locus tag: SAUSA300_1422 [new locus tag: SAUSA300_RS07760 ]
- pan locus tag?: SAUPAN001451000
- symbol: SAUSA300_1422
- pan gene symbol?: —
- synonym:
- product: phiSLT ORF65-like protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAUSA300_1422 [new locus tag: SAUSA300_RS07760 ]
- symbol: SAUSA300_1422
- product: phiSLT ORF65-like protein
- replicon: chromosome
- strand: -
- coordinates: 1581200..1581385
- length: 186
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3914364 NCBI
- RefSeq: YP_494119 NCBI
- BioCyc: GH3C-1417 BioCyc
- MicrobesOnline: 1292937 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181ATGCAACATCAAGCTTATATCAATGCTTCTGTTGACATTAGAATTCCTACAGAAGTCGAA
AGTGTTAATTACAATCAGATTGATAAAGAAAAAGAGAATTTGGCGGACTATTTATTTAAT
AATCCAGGTGAACTATTAAAATATAACGTTATAAATATCAAGGTTTTAGATTTAGAGGTG
GAATGA60
120
180
186
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAUSA300_1422 [new locus tag: SAUSA300_RS07760 ]
- symbol: SAUSA300_1422
- description: phiSLT ORF65-like protein
- length: 61
- theoretical pI: 4.14293
- theoretical MW: 7108.94
- GRAVY: -0.431148
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED: Phage phi 11 orf19 protein homolog
- PFAM: no clan defined DUF3113; Protein of unknown function (DUF3113) (PF11310; HMM-score: 136.2)and 2 moreDUF4947; Domain of unknown function (DUF4947) (PF16305; HMM-score: 13.8)NdhO; Cyanobacterial and plant NDH-1 subunit O (PF11910; HMM-score: 13)
⊟Structure, modifications & interactions[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
- protein partners:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.005271
- TAT(Tat/SPI): 0.000245
- LIPO(Sec/SPII): 0.001125
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MQHQAYINASVDIRIPTEVESVNYNQIDKEKENLADYLFNNPGELLKYNVINIKVLDLEVE
⊟Experimental data[edit | edit source]
- experimentally validated: no data available
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: SAUSA300_1420 < SAUSA300_1421 < SAUSA300_1422 < polA < SAUSA300_1424 < SAUSA300_1425 < SAUSA300_1426 < SAUSA300_1427
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
⊟Relevant publications[edit | edit source]