From AureoWiki
Jump to navigation Jump to search
PangenomeCOLN315NCTC8325NewmanUSA300_FPR3757JSNZ04-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 10-JUN-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_1427 [new locus tag: SAUSA300_RS07785 ]
  • pan locus tag?: SAUPAN001435000
  • symbol: SAUSA300_1427
  • pan gene symbol?:
  • synonym:
  • product: phiSLT ORF86-like protein

Additional information (user-provided)[edit | edit source]

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAUSA300_1427 [new locus tag: SAUSA300_RS07785 ]
  • symbol: SAUSA300_1427
  • product: phiSLT ORF86-like protein
  • replicon: chromosome
  • strand: -
  • coordinates: 1585540..1585800
  • length: 261
  • essential: unknown

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Additional information (user-provided)[edit | edit source]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    ATGTATTACAAATTTGGTGAGATAAAAAATAAAATTATCAGCTTTAACGGGTTTGAATTT
    AAAGTGTCTGCGATGAAAAAACATGACGGTATCAGTATACAAATCAAGGATATGAATAAT
    ATTCCACTTAAATCATTTCATGTTGTAGATTTAAGCGAACTATATTTTGCGACGGATGCA
    ATGCGTGACGTTATAAACGAATGGATTGAAGAGAACACAGATGAACAGGACAGACTAATT
    AACTTAGTCATGAAATGGTAG
    60
    120
    180
    240
    261


Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SAUSA300_1427 [new locus tag: SAUSA300_RS07785 ]
  • symbol: SAUSA300_1427
  • description: phiSLT ORF86-like protein
  • length: 86
  • theoretical pI: 5.10222
  • theoretical MW: 10235.7
  • GRAVY: -0.327907

Function[edit | edit source]

  • TIGRFAM:
  • TheSEED  :
    • Hypothetical protein, PVL orf39 homolog [SA bacteriophages 11, Mu50B]
  • PFAM:
    no clan defined DUF1108; Protein of unknown function (DUF1108) (PF06531; HMM-score: 157.4)
    and 1 more
    GAT; GAT domain (PF03127; HMM-score: 15)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.6024
    • Cytoplasmic Membrane Score: 0.0189
    • Cell wall & surface Score: 0.0008
    • Extracellular Score: 0.3779
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.003131
    • TAT(Tat/SPI): 0.000126
    • LIPO(Sec/SPII): 0.000536
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Additional information (user-provided)[edit | edit source]

Protein sequence[edit | edit source]

  • MYYKFGEIKNKIISFNGFEFKVSAMKKHDGISIQIKDMNNIPLKSFHVVDLSELYFATDAMRDVINEWIEENTDEQDRLINLVMKW

Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Additional information (user-provided)[edit | edit source]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Additional information (user-provided)[edit | edit source]

Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]


Relevant publications[edit | edit source]