Jump to navigation
Jump to search
PangenomeCOLN315NCTC8325NewmanUSA300_FPR375704-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL0336 [new locus tag: SACOL_RS01690 ]
- pan locus tag?: SAUPAN001435000
- symbol: SACOL0336
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL0336 [new locus tag: SACOL_RS01690 ]
- symbol: SACOL0336
- product: hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 362544..362804
- length: 261
- essential: unknown
⊟Accession numbers[edit | edit source]
- Gene ID: 3236898 NCBI
- RefSeq: YP_185228 NCBI
- BioCyc: see SACOL_RS01690
- MicrobesOnline: 911807 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241ATGTATTACAAAGCGGGTGAGATAAAAAATAAAATTATAAACTTTAACGGGTTCGAATTT
AAAGTGTCTGCGATGAAGAGACATGACGGTATCAGTATACAAGTTAAGGATATGAATAAT
GTTCCACTTAAATCATTTCATGTCGTAGATTTAAGCGAACTATATATTGCAATGGATGCA
ATGCACGACGTTATAAACGAATGGATTGAAGAGAACACAGATGAACAGGACAGACTAATT
AACTTAGTCATGAAATGGTAG60
120
180
240
261
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL0336 [new locus tag: SACOL_RS01690 ]
- symbol: SACOL0336
- description: hypothetical protein
- length: 86
- theoretical pI: 5.0873
- theoretical MW: 10163.7
- GRAVY: -0.319767
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED :
- Hypothetical protein, PVL orf39 homolog [SA bacteriophages 11, Mu50B]
- PFAM: no clan defined DUF1108; Protein of unknown function (DUF1108) (PF06531; HMM-score: 127)and 1 moreGAT; GAT domain (PF03127; HMM-score: 13.8)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.002523
- TAT(Tat/SPI): 0.000109
- LIPO(Sec/SPII): 0.000402
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MYYKAGEIKNKIINFNGFEFKVSAMKRHDGISIQVKDMNNVPLKSFHVVDLSELYIAMDAMHDVINEWIEENTDEQDRLINLVMKW
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: SACOL0335 > SACOL0336 > SACOL0337 > SACOL0338 > ssb1 > SACOL0340 > SACOL0341 > SACOL0342 > SACOL0343 > SACOL0344 > SACOL0345 > SACOL0346 > SACOL0347 > SACOL0348 > SACOL0349 > SACOL0350 > SACOL0351 > SACOL0352 > SACOL0353 > SACOL0354 > SACOL0355 > SACOL0356 > dut
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: no data available
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
⊟Relevant publications[edit | edit source]