From AureoWiki
Jump to navigation Jump to search
PangenomeCOLN315NCTC8325NewmanUSA300_FPR3757JSNZ04-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 10-JUN-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL0349 [new locus tag: SACOL_RS01755 ]
  • pan locus tag?: SAUPAN001453000
  • symbol: SACOL0349
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Additional information (user-provided)[edit | edit source]

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SACOL0349 [new locus tag: SACOL_RS01755 ]
  • symbol: SACOL0349
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 368608..368865
  • length: 258
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Additional information (user-provided)[edit | edit source]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    ATGAAGTTGAACGAAGTATTCGCAACTAATTTAAGAGTAATCATGGCTAGAGATAACGTA
    AGTGTTCAAGATTTGCACAATGAAACTGGCGTATCAAGATCAACTATTAGTGGATATAAA
    AACGGAAAAGCTGAGATGGTTAACTTAAATGTATTAGATAAATTGGCAGATGCTCTAGGT
    GTTAATGTAAGTGAACTATTTACTAGAAATCACAACACGCACAAATTAGAGGATTGGATT
    AAAAAAGTAAATGTATAG
    60
    120
    180
    240
    258


Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SACOL0349 [new locus tag: SACOL_RS01755 ]
  • symbol: SACOL0349
  • description: hypothetical protein
  • length: 85
  • theoretical pI: 9.11945
  • theoretical MW: 9565.85
  • GRAVY: -0.341176

Function[edit | edit source]

  • TIGRFAM:
    Signal transduction Regulatory functions DNA interactions transcriptional regulator, y4mF family (TIGR03070; HMM-score: 15.1)
  • TheSEED  :
    • Phage transcriptional regulator cro
  • PFAM:
    HTH (CL0123) HTH_26; Cro/C1-type HTH DNA-binding domain (PF13443; HMM-score: 64.6)
    and 15 more
    HTH_3; Helix-turn-helix (PF01381; HMM-score: 33.3)
    HTH_31; Helix-turn-helix domain (PF13560; HMM-score: 32)
    HTH_19; Helix-turn-helix domain (PF12844; HMM-score: 30.8)
    HTH_11; HTH domain (PF08279; HMM-score: 21.2)
    TetR_N; Bacterial regulatory proteins, tetR family (PF00440; HMM-score: 17.5)
    DUF6262; Family of unknown function (DUF6262) (PF19776; HMM-score: 15.9)
    HTH_37; Helix-turn-helix domain (PF13744; HMM-score: 15.8)
    HTH_IclR; IclR helix-turn-helix domain (PF09339; HMM-score: 15.2)
    Met_repress (CL0057) RHH_1; Ribbon-helix-helix protein, copG family (PF01402; HMM-score: 14.5)
    HTH (CL0123) MarR_2; MarR family (PF12802; HMM-score: 14.3)
    HTH_5; Bacterial regulatory protein, arsR family (PF01022; HMM-score: 13.6)
    no clan defined Arc_PepC; Archaeal Peptidase A24 C-terminal Domain (PF06819; HMM-score: 13.5)
    Ribosomal_S24e; Ribosomal protein S24e (PF01282; HMM-score: 12.6)
    HTH (CL0123) HTH_23; Homeodomain-like domain (PF13384; HMM-score: 11.9)
    Met_repress (CL0057) RHH_3; Ribbon-helix-helix domain (PF12651; HMM-score: 11.8)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9596
    • Cytoplasmic Membrane Score: 0.0007
    • Cell wall & surface Score: 0.0004
    • Extracellular Score: 0.0393
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.00715
    • TAT(Tat/SPI): 0.000363
    • LIPO(Sec/SPII): 0.000844
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Additional information (user-provided)[edit | edit source]

Protein sequence[edit | edit source]

  • MKLNEVFATNLRVIMARDNVSVQDLHNETGVSRSTISGYKNGKAEMVNLNVLDKLADALGVNVSELFTRNHNTHKLEDWIKKVNV

Experimental data[edit | edit source]

  • experimentally validated: data available for NCTC8325
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Additional information (user-provided)[edit | edit source]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Additional information (user-provided)[edit | edit source]

Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]


Relevant publications[edit | edit source]