Jump to navigation
Jump to search
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus USA300_FPR3757
- locus tag: SAUSA300_RS07785 [old locus tag: SAUSA300_1427 ]
- pan locus tag?: SAUPAN001435000
- symbol: SAUSA300_RS07785
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAUSA300_RS07785 [old locus tag: SAUSA300_1427 ]
- symbol: SAUSA300_RS07785
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 1585540..1585824
- length: 285
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: NC_007793 (1585540..1585824) NCBI
- BioCyc: SAUSA300_RS07785 BioCyc
- MicrobesOnline: see SAUSA300_1427
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241ATGATAACAAGGAGGGCTAAAACAATGTATTACAAATTTGGTGAGATAAAAAATAAAATT
ATCAGCTTTAACGGGTTTGAATTTAAAGTGTCTGCGATGAAAAAACATGACGGTATCAGT
ATACAAATCAAGGATATGAATAATATTCCACTTAAATCATTTCATGTTGTAGATTTAAGC
GAACTATATTTTGCGACGGATGCAATGCGTGACGTTATAAACGAATGGATTGAAGAGAAC
ACAGATGAACAGGACAGACTAATTAACTTAGTCATGAAATGGTAG60
120
180
240
285
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAUSA300_RS07785 [old locus tag: SAUSA300_1427 ]
- symbol: SAUSA300_RS07785
- description: hypothetical protein
- length: 94
- theoretical pI: 7.6813
- theoretical MW: 11193.9
- GRAVY: -0.364894
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED: see SAUSA300_1427
- PFAM: no clan defined DUF1108; Protein of unknown function (DUF1108) (PF06531; HMM-score: 156.9)and 2 moreGAT; GAT domain (PF03127; HMM-score: 14.7)DUF2746; Protein of unknown function (DUF2746) (PF10874; HMM-score: 13)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.6558
- Cytoplasmic Membrane Score: 0.0147
- Cell wall & surface Score: 0.0009
- Extracellular Score: 0.3286
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.003739
- TAT(Tat/SPI): 0.000328
- LIPO(Sec/SPII): 0.000514
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI: see SAUSA300_1427
- RefSeq: WP_001802832 NCBI
- UniProt: see SAUSA300_1427
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MITRRAKTMYYKFGEIKNKIISFNGFEFKVSAMKKHDGISIQIKDMNNIPLKSFHVVDLSELYFATDAMRDVINEWIEENTDEQDRLINLVMKW
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: no data available
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]