From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_2302 [new locus tag: SAUSA300_RS12720 ]
  • pan locus tag?: SAUPAN005861000
  • symbol: tcaA
  • pan gene symbol?: tcaA
  • synonym:
  • product: teicoplanin resistance associated membrane protein TcaA protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAUSA300_2302 [new locus tag: SAUSA300_RS12720 ]
  • symbol: tcaA
  • product: teicoplanin resistance associated membrane protein TcaA protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2474723..2476105
  • length: 1383
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    901
    961
    1021
    1081
    1141
    1201
    1261
    1321
    1381
    ATGAAATCTTGCCCGAAGTGCGGACAACAAGCACAAGATGATGTACAGATATGTACACAA
    TGTGGACATAAATTTGATAGTCGTCAAGCATTATATAGAAAGTCAACCGATGAAGATATA
    CAAACTAATAACATCAAGATGAGAAAAATGGTGCCTTGGGCAATTGGTTTTTTCATTTTA
    ATCTTAATTATTATATTGTTCTTTTTACTAAGAAACTTCAATTCACCTGAAGCGCAAACT
    AAAATATTAGTGAATGCGATTGAGAATAATGATAAACAAAAAGTAGCAACATTATTAAGT
    ACTAAAGATAATAAAGTAGATTCTGAAGAAGCAAAAGTATACATTAACTATATCAAAGAT
    GAAGTTGGGCTTAAGCAATTTGTCAGCGACCTTAAAAATACGGTACATAAATTGAATAAG
    AGTAAGACCAGCGTAGCTTCTTATATTCAAACCAGATCTGGTCAAAATATATTACGTGTA
    AGTAAAAATGGCACACGTTATATCTTTTTCGATAATATGAGCTTTACTGCACCTACCAAG
    CAACCAATTGTTAAACCGAAAGAAAAAACAAAATATGAGTTTAAATCTGGTGGTAAGAAA
    AAGATGGTTATAGCTGAAGCAAATAAAGTGACGCCAATAGGTAATTTTATACCGGGGACA
    TATAGAATTCCAGCTATGAAATCAACTGAGAACGGTGATTTTGCAGGCCATTTAAAATTT
    GATTTTAGACAAAGTAATTCTGAAACGGTAGATGTTACTGAAGATTTTGAAGAAGCAAAT
    ATATCTGTAACTTTAAAAGGCGATACAAAATTAAATGATAGTTCTAAAAAAGTAACTATA
    AATGACCATGAAATGGCATTTTCAAGTTCCAAAACGTATGGTCCATATCCACAAAATAAA
    GATATTACCATTTCAGCTTCAGGTAAAGCGAAAGATAAAACATTTACAACACAGACGAAG
    ACGATTAAAGCTAGCGATTTAAAATACAATACAGAGATAACTTTGAATTTTGACAGTGAA
    GATATCGAAGACTATGTTGAAAAGAAAGAAAAAGAAGAAAACAGCTTGAAGAACAAATTG
    ATAGAATTCTTTGCTGGATATTCTTTAGCGAATAATGCTGCGTTTAATCAGTCGGATTTT
    GATTTTGTATCATCATATATAAAAAAAGGATCATCTTTTTATGATGATGTAAAGAAGCGT
    GTATCTAAAGGAAGTTTAATGATGATTAGTTCACCACAAATTATAGATGCTGAAAAACAT
    GGTGATAAGATTACCGCAACCGTAAGATTAATAAATGAAAACGGTAAGCAAGTAGATAAA
    GAATATGAGCTTGAACAAGGCTCGCAAGACCGCTTGCAATTAATCAAGACATCAGAAAAA
    TAG
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    900
    960
    1020
    1080
    1140
    1200
    1260
    1320
    1380
    1383

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SAUSA300_2302 [new locus tag: SAUSA300_RS12720 ]
  • symbol: TcaA
  • description: teicoplanin resistance associated membrane protein TcaA protein
  • length: 460
  • theoretical pI: 9.47124
  • theoretical MW: 52113.8
  • GRAVY: -0.652826

Function[edit | edit source]

  • TIGRFAM:
    Signal transduction Regulatory functions DNA interactions putative regulatory protein, FmdB family (TIGR02605; HMM-score: 13.7)
    and 1 more
    Cys-rich peptide, TIGR04165 family (TIGR04165; HMM-score: 5.7)
  • TheSEED:  
    Virulence, Disease and Defense Resistance to antibiotics and toxic compounds Teicoplanin-resistance in Staphylococcus  Teicoplanin resistance associated membrane protein TcaA
  • PFAM:
    Zn_Beta_Ribbon (CL0167) zf-ribbon_3; zinc-ribbon domain (PF13248; HMM-score: 28.3)
    zinc_ribbon_2; zinc-ribbon domain (PF13240; HMM-score: 25.3)
    and 13 more
    UPF0547; Uncharacterised protein family UPF0547 (PF10571; HMM-score: 19.3)
    DZR; Double zinc ribbon (PF12773; HMM-score: 18.5)
    Zn-ribbon_8; Zinc ribbon domain (PF09723; HMM-score: 15.3)
    no clan defined DUF2950; Protein of unknown function (DUF2950) (PF11453; HMM-score: 14.1)
    ClpP_crotonase (CL0127) CLP_protease; Clp protease (PF00574; HMM-score: 14)
    MBB (CL0193) OprB; Carbohydrate-selective porin, OprB family (PF04966; HMM-score: 13.8)
    no clan defined DUF1461; Protein of unknown function (DUF1461) (PF07314; HMM-score: 11.6)
    Zn_Beta_Ribbon (CL0167) zinc_ribbon_15; zinc-ribbon family (PF17032; HMM-score: 11)
    RING (CL0229) Prok-RING_1; Prokaryotic RING finger family 1 (PF14446; HMM-score: 10.9)
    ABC-2 (CL0181) ABC2_membrane_3; ABC-2 family transporter protein (PF12698; HMM-score: 10.3)
    Transporter (CL0375) Clc-like; Clc-like (PF07062; HMM-score: 10)
    Zn_Beta_Ribbon (CL0167) OrfB_Zn_ribbon; Putative transposase DNA-binding domain (PF07282; HMM-score: 9.3)
    no clan defined YhfH; YhfH-like protein (PF14149; HMM-score: 9.3)

Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helix: 1
  • LocateP: N-terminally anchored (No CS)
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular possibility: 0.17
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 4
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.008059
    • TAT(Tat/SPI): 0.000171
    • LIPO(Sec/SPII): 0.029427
  • predicted transmembrane helices (TMHMM): 1

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MKSCPKCGQQAQDDVQICTQCGHKFDSRQALYRKSTDEDIQTNNIKMRKMVPWAIGFFILILIIILFFLLRNFNSPEAQTKILVNAIENNDKQKVATLLSTKDNKVDSEEAKVYINYIKDEVGLKQFVSDLKNTVHKLNKSKTSVASYIQTRSGQNILRVSKNGTRYIFFDNMSFTAPTKQPIVKPKEKTKYEFKSGGKKKMVIAEANKVTPIGNFIPGTYRIPAMKSTENGDFAGHLKFDFRQSNSETVDVTEDFEEANISVTLKGDTKLNDSSKKVTINDHEMAFSSSKTYGPYPQNKDITISASGKAKDKTFTTQTKTIKASDLKYNTEITLNFDSEDIEDYVEKKEKEENSLKNKLIEFFAGYSLANNAAFNQSDFDFVSSYIKKGSSFYDDVKKRVSKGSLMMISSPQIIDAEKHGDKITATVRLINENGKQVDKEYELEQGSQDRLQLIKTSEK

Experimental data[edit | edit source]

  • experimentally validated: no data available

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

  • tcaA no polycistronic organisation predicted

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]