Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus USA300_FPR3757
- locus tag: SAUSA300_2419 [new locus tag: SAUSA300_RS13390 ]
- pan locus tag?: SAUPAN006040000
- symbol: SAUSA300_2419
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAUSA300_2419 [new locus tag: SAUSA300_RS13390 ]
- symbol: SAUSA300_2419
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 2605508..2605927
- length: 420
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3914825 NCBI
- RefSeq: YP_495054 NCBI
- BioCyc: see SAUSA300_RS13390
- MicrobesOnline: 1293934 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361ATGTCCAAAAAACATGTTTTTATAATTATTGGTGTCATATTGTGTATATGTACAGTTTCT
ACGGTCATGCATTTTAAAATGAAATATGATGAAAAAGAAAAACAAAAAGCGATTTACTAC
AAAGAACAACAAGAACGTATTACACTCTATCTTAAGCATAATACTAAAGAAACGAACACG
ATTAAATCTGTACATTTCACAAACTTGGAAACAAGTCCTATGGGAAGTGCTGTGATTGAA
GGATACATCAATGAAAATAAAGAAGATGATTTTACTGCTTATGCATCGCCTGAACATAAT
TATCAATTTGGTGGCGCTATGATAAAAAGTGAAGGAGTAGATAAATTATTAAAACCAGCA
CATGAAAGAAAATCACCAGAAAAAATCAAAGAAGAATTAGATAAAAAAGAAGGCCACTAG60
120
180
240
300
360
420
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAUSA300_2419 [new locus tag: SAUSA300_RS13390 ]
- symbol: SAUSA300_2419
- description: hypothetical protein
- length: 139
- theoretical pI: 8.22284
- theoretical MW: 16097.4
- GRAVY: -0.716547
⊟Function[edit | edit source]
- TIGRFAM: Transport and binding proteins Carbohydrates, organic alcohols, and acids D-galactonate transporter (TIGR00893; HMM-score: 11.2)
- TheSEED :
- FIG01108221: hypothetical protein
- PFAM: no clan defined DUF1433; Protein of unknown function (DUF1433) (PF07252; HMM-score: 135.8)and 3 moreDUF7299; Family of unknown function (DUF7299) (PF23973; HMM-score: 15.6)TRAP (CL0757) GAPT; GRB2-binding adapter (GAPT) (PF11770; HMM-score: 14.9)no clan defined DUF1310; Protein of unknown function (DUF1310) (PF07006; HMM-score: 14.2)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helix: 1
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 0.7139
- Cell wall & surface Score: 0.0007
- Extracellular Score: 0.2854
- LocateP: N-terminally anchored (No CS)
- Prediction by SwissProt Classification: Membrane
- Pathway Prediction: Sec-(SPI)
- Intracellular possibility: 0.17
- Signal peptide possibility: -0.5
- N-terminally Anchored Score: 2
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.252761
- TAT(Tat/SPI): 0.002357
- LIPO(Sec/SPII): 0.30525
- predicted transmembrane helices (TMHMM): 1
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MSKKHVFIIIGVILCICTVSTVMHFKMKYDEKEKQKAIYYKEQQERITLYLKHNTKETNTIKSVHFTNLETSPMGSAVIEGYINENKEDDFTAYASPEHNYQFGGAMIKSEGVDKLLKPAHERKSPEKIKEELDKKEGH
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]