From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_2618 [new locus tag: SAUSA300_RS14550 ]
  • pan locus tag?: SAUPAN006441000
  • symbol: SAUSA300_2618
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAUSA300_2618 [new locus tag: SAUSA300_RS14550 ]
  • symbol: SAUSA300_2618
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2845219..2845773
  • length: 555
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    ATGAAAAAACAAGATATTTCAGTTAAAACTGTTGTTGCAATTGGTATAGGAGCAGCGGTA
    TTTGTAATTTTAGGGCGTTTTGTTGTAATACCAACAGGTTTTCCTAATACGAATATAGAA
    ACATCATATGCATTTTTAGCATTAATATCTGCAATATTTGGACCTTTTGCTGGTTTAATG
    ACTGGATTAGTTGGACATGCTATTAAAGATTTTACGACATACGGTAGTGCCTGGTGGAGT
    TGGGTTATTTGCTCGGGAATTATAGGCTGTTTATATGGCTGGATTGGACTAAAATTAAAT
    CTTTCTTCAGGCCGATTTTCTAGGAAATCGATGGTTTATTTTAATATCGGTCAAATTATT
    GCGAATATTATTTGCTGGGCACTTATTGCACCAACATTAGATATTTTGATTTATAACGAA
    CCAGCTAACAAGGTTTATACACAAGGTGTTATCTCTGCAGTATTAAATATTATTTCAGTT
    GGCATTATTGGGACAATATTATTAAAAGCATATGCTTCATCTCAAATTAAAAAAGGTAGT
    TTACGTAAGGAATAG
    60
    120
    180
    240
    300
    360
    420
    480
    540
    555

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SAUSA300_2618 [new locus tag: SAUSA300_RS14550 ]
  • symbol: SAUSA300_2618
  • description: hypothetical protein
  • length: 184
  • theoretical pI: 10.0688
  • theoretical MW: 19839.4
  • GRAVY: 0.747283

Function[edit | edit source]

  • TIGRFAM:
    Metabolism Transport and binding proteins Unknown substrate ECF transporter S component, folate family (TIGR04518; HMM-score: 36.9)
  • TheSEED:  
    Amino Acids and Derivatives Lysine, threonine, methionine, and cysteine Methionine Biosynthesis  Substrate-specific component MtsA of methionine-regulated ECF transporter
    and 1 more
    Membrane Transport Membrane Transport - no subcategory ECF class transporters  Substrate-specific component MtsA of methionine-regulated ECF transporter
  • PFAM:
    Gx_transp (CL0315) ECF-ribofla_trS; ECF-type riboflavin transporter, S component (PF07155; HMM-score: 173.3)
    and 3 more
    ECF_trnsprt; ECF transporter, substrate-specific component (PF12822; HMM-score: 30.7)
    no clan defined Glycophorin_A; Glycophorin A (PF01102; HMM-score: 12.7)
    DUF3021; Protein of unknown function (DUF3021) (PF11457; HMM-score: 7.1)

Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 10
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 5
  • LocateP: Multi-transmembrane
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular possibility: 0.17
    • Signal peptide possibility: 0
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.043392
    • TAT(Tat/SPI): 0.001417
    • LIPO(Sec/SPII): 0.012129
  • predicted transmembrane helices (TMHMM): 5

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MKKQDISVKTVVAIGIGAAVFVILGRFVVIPTGFPNTNIETSYAFLALISAIFGPFAGLMTGLVGHAIKDFTTYGSAWWSWVICSGIIGCLYGWIGLKLNLSSGRFSRKSMVYFNIGQIIANIICWALIAPTLDILIYNEPANKVYTQGVISAVLNIISVGIIGTILLKAYASSQIKKGSLRKE

Experimental data[edit | edit source]

  • experimentally validated: no data available

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]