From AureoWiki
Jump to navigation Jump to search

NCBI: 02-MAR-2017

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_RS00905 [old locus tag: SAUSA300_0172 ]
  • pan locus tag?: SAUPAN001008000
  • symbol: SAUSA300_RS00905
  • pan gene symbol?: —
  • synonym:
  • product: hypothetical protein

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SAUSA300_RS00905 [old locus tag: SAUSA300_0172 ]
  • symbol: SAUSA300_RS00905
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 195092..195295
  • length: 204
  • essential: unknown other strains

⊟Accession numbers[edit | edit source]

⊟Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    ATGGATAAAGAATCTGTCGTAGCAAGTTTAGCTAGAAACAAAAAGATTGCTGTAGAAACA
    ATGGCCGGTCAAAGGTACATCATAGAACGCATTTTACATACAAATGATGAAAAACATATT
    CATATTTTGAAACCTAAAGATGTCGTGTTAGATGTAGATAGCATCAAAGAAATTGACGAA
    AATCATTTAAATGATGCAACATAA
    60
    120
    180
    204

⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: SAUSA300_RS00905 [old locus tag: SAUSA300_0172 ]
  • symbol: SAUSA300_RS00905
  • description: hypothetical protein
  • length: 67
  • theoretical pI: 6.08298
  • theoretical MW: 7662.71
  • GRAVY: -0.468657

⊟Function[edit | edit source]

  • TIGRFAM:
    Metabolism Energy metabolism Amino acids and amines quinohemoprotein amine dehydrogenase, alpha subunit (TIGR03908; EC 1.4.-.-; HMM-score: 13.1)
  • TheSEED: see SAUSA300_0172
  • PFAM:

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.002531
    • TAT(Tat/SPI): 0.000303
    • LIPO(Sec/SPII): 0.000631
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MDKESVVASLARNKKIAVETMAGQRYIIERILHTNDEKHIHILKPKDVVLDVDSIKEIDENHLNDAT

⊟Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

⊟Literature[edit | edit source]

⊟References[edit | edit source]

⊟Relevant publications[edit | edit source]

Retrieved from "http://aureowiki.med.uni-greifswald.de/index.php?title=SAUSA300_RS00905&oldid=90945"