From AureoWiki
Jump to navigation Jump to search

NCBI: 02-MAR-2017

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_RS01845 [old locus tag: SAUSA300_0348 ]
  • pan locus tag?: SAUPAN001890000
  • symbol: SAUSA300_RS01845
  • pan gene symbol?: tatA
  • synonym:
  • product: twin-arginine translocase TatA/TatE family subunit

⊟Additional information (user-provided)[edit | edit source]

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SAUSA300_RS01845 [old locus tag: SAUSA300_0348 ]
  • symbol: SAUSA300_RS01845
  • product: twin-arginine translocase TatA/TatE family subunit
  • replicon: chromosome
  • strand: -
  • coordinates: 400607..400831
  • length: 225
  • essential: unknown other strains

⊟Accession numbers[edit | edit source]

⊟Phenotype[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    TTGATTATCATGATAACTAACACTTTTATTTTAGGCATCACAGGCCCAACAAGTCTTGTC
    GTCATTAGCATTATCGCTTTAATTATTTTTGGTCCGAAAAAATTACCACAATTTGGCCGT
    GCCATCGGTTCTACTTTAAAAGAATTTAAATCTGCAACAGAAGATTTAGATAAAGAGTCT
    CACGATACACCCAGTAAGGAATCGAAACAACAGCGAGAGCAATAG
    60
    120
    180
    225


⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: SAUSA300_RS01845 [old locus tag: SAUSA300_0348 ]
  • symbol: SAUSA300_RS01845
  • description: twin-arginine translocase TatA/TatE family subunit
  • length: 74
  • theoretical pI: 9.23936
  • theoretical MW: 8159.47
  • GRAVY: -0.0378378

⊟Function[edit | edit source]

  • TIGRFAM:
    Genetic information processing Protein fate Protein and peptide secretion and trafficking twin arginine-targeting protein translocase, TatA/E family (TIGR01411; HMM-score: 67.9)
    and 1 more
    Genetic information processing Protein fate Protein and peptide secretion and trafficking twin arginine-targeting protein translocase TatB (TIGR01410; HMM-score: 34.3)
  • TheSEED: see SAUSA300_0348
  • PFAM:
    no clan defined TatA_B_E; mttA/Hcf106 family (PF02416; HMM-score: 70.9)
    and 1 more
    CPP1-like; Protein CHAPERONE-LIKE PROTEIN OF POR1-like (PF11833; HMM-score: 12.6)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.17
    • Cytoplasmic Membrane Score: 9.51
    • Cellwall Score: 0.16
    • Extracellular Score: 0.15
    • Internal Helix: 1
  • DeepLocPro: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 0.9941
    • Cell wall & surface Score: 0
    • Extracellular Score: 0.0059
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.04799
    • TAT(Tat/SPI): 0.00091
    • LIPO(Sec/SPII): 0.003495
  • predicted transmembrane helices (TMHMM): 1

⊟Accession numbers[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MIIMITNTFILGITGPTSLVVISIIALIIFGPKKLPQFGRAIGSTLKEFKSATEDLDKESHDTPSKESKQQREQ

⊟Experimental data[edit | edit source]

  • experimentally validated: data available for NCTC8325
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

⊟Literature[edit | edit source]

⊟References[edit | edit source]


⊟Relevant publications[edit | edit source]