From AureoWiki
Jump to navigation Jump to search

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_RS02005 [old locus tag: SAUSA300_0376 ]
  • pan locus tag?: SAUPAN001976000
  • symbol: SAUSA300_RS02005
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAUSA300_RS02005 [old locus tag: SAUSA300_0376 ]
  • symbol: SAUSA300_RS02005
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 426163..426546
  • length: 384
  • essential: unknown

Accession numbers[edit | edit source]

  • Location: NC_007793 (426163..426546) NCBI
  • BioCyc:
  • MicrobesOnline:

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    ATGAAAGTTCGAATTACTTTTATTATTTTAGCAATTTTATCGACGATTGTTTGCTTGTTC
    TTAGCAGCAATGCATCCAACAGGACCAAACACAGTAACTTTTGAACAGCCATATTTATTC
    ACCCTCAACATCATTATAATGGTATTAGTCGCATTACCTTCACTTGTTTTAGCTATATAT
    GATTATATGAGTTTTAGAATTTCTTCTGCTATTTTACAATTTCTAGGGGCTATCTCTTGG
    TTCTTTTTATCATTGATATTATCGCTCACACAATTTACACCTTTTACATTAGCGTCATTT
    ATAACTTCAATTATTTTGTTCACAAGCACAATTATCACATTAGCCATTGGTGGTAAGTCT
    GTTGAAAAGAATGATTCCCCTTAA
    60
    120
    180
    240
    300
    360
    384

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SAUSA300_RS02005 [old locus tag: SAUSA300_0376 ]
  • symbol: SAUSA300_RS02005
  • description: hypothetical protein
  • length: 127
  • theoretical pI: 8.48433
  • theoretical MW: 14027.8
  • GRAVY: 1.20157

Function[edit | edit source]

  • TIGRFAM:
    Metabolism Energy metabolism Electron transport caa(3)-type oxidase, subunit IV (TIGR02229; HMM-score: 7.7)
  • TheSEED:
  • PFAM:
    no clan defined Herpes_LMP1; Herpesvirus latent membrane protein 1 (LMP1) (PF05297; HMM-score: 6.9)
    Gaa1; Gaa1-like, GPI transamidase component (PF04114; HMM-score: 5.8)
    and 1 more
    DUF2070; Predicted membrane protein (DUF2070) (PF09843; HMM-score: 4.3)

Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 10
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 4
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.165109
    • TAT(Tat/SPI): 0.003325
    • LIPO(Sec/SPII): 0.376101
  • predicted transmembrane helices (TMHMM): 4

Accession numbers[edit | edit source]

  • GI: 446790992 NCBI
  • RefSeq: WP_000868248 NCBI
  • UniProt:

Protein sequence[edit | edit source]

  • MKVRITFIILAILSTIVCLFLAAMHPTGPNTVTFEQPYLFTLNIIIMVLVALPSLVLAIYDYMSFRISSAILQFLGAISWFFLSLILSLTQFTPFTLASFITSIILFTSTIITLAIGGKSVEKNDSP

Experimental data[edit | edit source]

  • experimentally validated: no data available

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]