From AureoWiki
Jump to navigation Jump to search

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_RS03075 [old locus tag: SAUSA300_0575 ]
  • pan locus tag?: SAUPAN002374000
  • symbol: SAUSA300_RS03075
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAUSA300_RS03075 [old locus tag: SAUSA300_0575 ]
  • symbol: SAUSA300_RS03075
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 649865..650206
  • length: 342
  • essential: unknown

Accession numbers[edit | edit source]

  • Location: NC_007793 (649865..650206) NCBI
  • BioCyc:
  • MicrobesOnline:

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    ATGAAAAATACATTCCTTATTTGTGATGAATGTCAGGCAGTCAATATAAGAACGTTACAA
    AAGAAGTTGGAAAAATTAGATCCCGATGCTGAAATCGTGATAGGTTGTCAATCTTATTGT
    GGACCTGGACGCCGAAAAACATTCACTTTTGTTAATAACCGCCCACTGGCTGCGCTTACT
    GAAGAAGAATTAATCGAAAAAGTTTCTCAACAATTAAAGAAACCACGTGATCCTGAAGAA
    GAAGAGCGTTTAAGAAAACGACATGAAGAACGTAAACGTCGTAAAGTAGAACAAGATAGA
    AAGCTTAAAGAAAAATTAGAAAAGCGAAAAGCACAACAATAA
    60
    120
    180
    240
    300
    342

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SAUSA300_RS03075 [old locus tag: SAUSA300_0575 ]
  • symbol: SAUSA300_RS03075
  • description: hypothetical protein
  • length: 113
  • theoretical pI: 10.0861
  • theoretical MW: 13505.5
  • GRAVY: -1.24425

Function[edit | edit source]

  • TIGRFAM:
    Genetic information processing Protein synthesis tRNA aminoacylation glutamyl-tRNA(Gln) amidotransferase, subunit D (TIGR02153; EC 6.3.5.-; HMM-score: 10)
  • TheSEED:
  • PFAM:
    no clan defined DUF1450; Protein of unknown function (DUF1450) (PF07293; HMM-score: 32.5)
    and 2 more
    Zn_Beta_Ribbon (CL0167) DUF2072; Zn-ribbon containing protein (PF09845; HMM-score: 15.4)
    BCLiA (CL0551) APG6; Autophagy protein Apg6 (PF04111; HMM-score: 8.2)

Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.013811
    • TAT(Tat/SPI): 0.000256
    • LIPO(Sec/SPII): 0.010296
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

  • GI: 446721655 NCBI
  • RefSeq: WP_000798968 NCBI
  • UniProt:

Protein sequence[edit | edit source]

  • MKNTFLICDECQAVNIRTLQKKLEKLDPDAEIVIGCQSYCGPGRRKTFTFVNNRPLAALTEEELIEKVSQQLKKPRDPEEEERLRKRHEERKRRKVEQDRKLKEKLEKRKAQQ

Experimental data[edit | edit source]

  • experimentally validated: no data available

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]