Jump to navigation
Jump to search
PangenomeCOLN315NCTC8325NewmanUSA300_FPR3757JSNZ04-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus USA300_FPR3757
- locus tag: SAUSA300_RS04335 [old locus tag: SAUSA300_0803 ]
- pan locus tag?: SAUPAN002847000
- symbol: SAUSA300_RS04335
- pan gene symbol?: —
- synonym:
- product: transcriptional regulator
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAUSA300_RS04335 [old locus tag: SAUSA300_0803 ]
- symbol: SAUSA300_RS04335
- product: transcriptional regulator
- replicon: chromosome
- strand: -
- coordinates: 885271..885603
- length: 333
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: NC_007793 (885271..885603) NCBI
- BioCyc: SAUSA300_RS04335 BioCyc
- MicrobesOnline: see SAUSA300_0803
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGAGAACTAATGATGAAATAATCACAATAATTAAAACATCAATGAAAGAACAAAATATG
TCACTAAGTGAATTAGCTCGTCGTGTAGGTGTAGCAAAATCAGCAGTATCAAGATATTTA
AATTTAACTAGAGAGTTCCCATTGAATCGTGCTGAAGATTTTGCGAAAGTACTTGGAATA
AAAACAGAATATTTATTAGGATTTGCTGAACGCGAAGAATCTACAAAACAAGATACTATC
GCCGCGCACTTAGATGGAGATTTTACAGAGGAAGAATTAATTGAAATTAGAAAGTATGCG
GAGTTAGTTAGAAAAGCACATCGAAATCAGTAA60
120
180
240
300
333
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAUSA300_RS04335 [old locus tag: SAUSA300_0803 ]
- symbol: SAUSA300_RS04335
- description: transcriptional regulator
- length: 110
- theoretical pI: 6.54552
- theoretical MW: 12702.4
- GRAVY: -0.553636
⊟Function[edit | edit source]
- TIGRFAM: Mobile and extrachromosomal element functions Other addiction module antidote protein, HigA family (TIGR02607; HMM-score: 19.4)Regulatory functions DNA interactions addiction module antidote protein, HigA family (TIGR02607; HMM-score: 19.4)Regulatory functions Protein interactions addiction module antidote protein, HigA family (TIGR02607; HMM-score: 19.4)Mobile and extrachromosomal element functions Prophage functions phage-associated protein, BcepMu gp16 family (TIGR04111; HMM-score: 16.3)and 2 moreputative zinc finger/helix-turn-helix protein, YgiT family (TIGR03830; HMM-score: 13.6)RNA polymerase sigma factor, sigma-70 family (TIGR02937; HMM-score: 13.4)
- TheSEED: see SAUSA300_0803
- PFAM: HTH (CL0123) HTH_3; Helix-turn-helix (PF01381; HMM-score: 42.5)and 34 moreHTH_26; Cro/C1-type HTH DNA-binding domain (PF13443; HMM-score: 32.4)HTH_IclR; IclR helix-turn-helix domain (PF09339; HMM-score: 24.8)HTH_31; Helix-turn-helix domain (PF13560; HMM-score: 24.1)HTH_5; Bacterial regulatory protein, arsR family (PF01022; HMM-score: 22.3)HTH_24; Winged helix-turn-helix DNA-binding (PF13412; HMM-score: 20.8)HTH_38; Helix-turn-helix domain (PF13936; HMM-score: 20)HTH_Tnp_Tc3_1; Tc3 transposase (PF11427; HMM-score: 19.3)LacI; Bacterial regulatory proteins, lacI family (PF00356; HMM-score: 18.1)HTH_35; Winged helix-turn-helix DNA-binding (PF13693; HMM-score: 17.9)MarR; MarR family (PF01047; HMM-score: 17.1)HTH_10; HTH DNA binding domain (PF04967; HMM-score: 16.6)MarR_2; MarR family (PF12802; HMM-score: 16.5)HTH_AsnC-type; AsnC-type helix-turn-helix domain (PF13404; HMM-score: 16.5)no clan defined DUF5097; Domain of unknown function (DUF5097) (PF17020; HMM-score: 16.2)HTH (CL0123) CENP-B_N; CENP-B N-terminal DNA-binding domain (PF04218; HMM-score: 15.9)HTH_37; Helix-turn-helix domain (PF13744; HMM-score: 15.8)YdaS_toxin; Bacterial toxin YdaS (PF15943; HMM-score: 15.7)Met_repress (CL0057) NikA-like; Mobilization protein NikA (PF21983; HMM-score: 15.6)HTH (CL0123) TetR_N; Bacterial regulatory proteins, tetR family (PF00440; HMM-score: 14.9)Phage_CI_repr; Bacteriophage CI repressor helix-turn-helix domain (PF07022; HMM-score: 14.8)HTH_7; Helix-turn-helix domain of resolvase (PF02796; HMM-score: 14.2)HTH_23; Homeodomain-like domain (PF13384; HMM-score: 13.9)HTH_19; Helix-turn-helix domain (PF12844; HMM-score: 13.8)Sigma70_r4; Sigma-70, region 4 (PF04545; HMM-score: 13.7)HTH_29; Winged helix-turn helix (PF13551; HMM-score: 13.7)DUF6471; Domain of unknown function (DUF6471) (PF20075; HMM-score: 13.6)PuR_N; Bacterial purine repressor, N-terminal (PF09182; HMM-score: 13.4)HTH_20; Helix-turn-helix domain (PF12840; HMM-score: 13.4)BetR; BetR domain (PF08667; HMM-score: 13.3)HTH_Crp_2; Crp-like helix-turn-helix domain (PF13545; HMM-score: 13.1)HTH_11; HTH domain (PF08279; HMM-score: 12.9)DUF7726; Domain of unknown function (DUF7726) (PF24852; HMM-score: 12.4)HTH_Tnp_ISL3; Helix-turn-helix domain of transposase family ISL3 (PF13542; HMM-score: 12.3)P22_Cro; DNA-binding transcriptional regulator Cro (PF14549; HMM-score: 12)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9923
- Cytoplasmic Membrane Score: 0.0013
- Cell wall & surface Score: 0.0001
- Extracellular Score: 0.0063
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.011244
- TAT(Tat/SPI): 0.001592
- LIPO(Sec/SPII): 0.000913
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI: 447182748 NCBI
- RefSeq: WP_001260004 NCBI
- UniProt: see SAUSA300_0803
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MRTNDEIITIIKTSMKEQNMSLSELARRVGVAKSAVSRYLNLTREFPLNRAEDFAKVLGIKTEYLLGFAEREESTKQDTIAAHLDGDFTEEELIEIRKYAELVRKAHRNQ
⊟Experimental data[edit | edit source]
- experimentally validated: data available for COL
- protein localization: data available for COL
- quantitative data / protein copy number per cell: data available for COL
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: no data available
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]