From AureoWiki
Jump to navigation Jump to search

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_RS06010 [old locus tag: SAUSA300_1110 ]
  • pan locus tag?: SAUPAN003500000
  • symbol: SAUSA300_RS06010
  • pan gene symbol?: sun
  • synonym:
  • product: 16S rRNA (cytosine(967)-C(5))-methyltransferase

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAUSA300_RS06010 [old locus tag: SAUSA300_1110 ]
  • symbol: SAUSA300_RS06010
  • product: 16S rRNA (cytosine(967)-C(5))-methyltransferase
  • replicon: chromosome
  • strand: +
  • coordinates: 1214998..1216305
  • length: 1308
  • essential: unknown

Accession numbers[edit | edit source]

  • Location: NC_007793 (1214998..1216305) NCBI
  • BioCyc:
  • MicrobesOnline:

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    901
    961
    1021
    1081
    1141
    1201
    1261
    ATGATAGAAAACGTGAGAAGTCTTGCTTTTGACACGATTCAAGATATATTAAATGAAGGT
    GCGTATAGTAACTTGCGTATCAATGAAGTGTTGTCAGAAAATGAATTAAATGCAATGGAT
    AAGGCTTTATTTACAGAAATTGTCTACGGAACCGTTAAAAGAAAATATACGTTAGATTTT
    TATTTAAAGCCTTTTGTGAAAACAAAGATTAAGGCATGGGTTAGGCAATTATTATGGATG
    AGTATTTATCAATATGTTTATTTAGATAAAGTTCCAAATCATGCCATTATTAATGAAGCA
    GTTGAAATAGCAAAAGAACGCGGTGGCTATCATAATGGTAATGTCGTAAATGGTATTTTA
    CGTACAATGATGCGTAGTGACTTACCTGATTTTAATGAAATTGCAGATCCTAAAAAAAGA
    ATGGCAATCGAGTATAGTATGCCGAAGTGGATTATAGATCATTGGGCAACACATTATGGT
    CTCGAAGAAACTGAAACAATTTTACAGTCATTTTTAGAAACGACATCAACAACTGTGCGT
    GCCAACCTGACGCGAGCATCATTAGATGATATTATTGAAAAGTTGCAAGACGAAGGTTAT
    GACGTTGAAAAAGATCATGACTTACCTTATTGTCTCCATATAGGAGGACAACCAATTATT
    CATTCTCGTTCATTTAAAGATGGATTCGTTTCAATTCAAGATAAAAGCTCAATGTTTGTT
    GCACACATTATGAATGTAGACCGACATGATCACGTATTAGATGCATGTAGTGCACCTGGC
    GGTAAAGCTTGTCACATTGCTGAAGTTTTAATGCCAGAAGGGCAAGTTGACGCTTCAGAT
    ATACATGATCACAAAATAGACTTAATTAATTTTAATATAAAAAAATTACGATTAACAAAT
    ATTAAAGCTTTTCAATATGATGCGACAAAACCTTATGATAAAACATACGATAAGATACTT
    GTTGATGCACCATGTAGCGGATTAGGTGTAATGAGACATAAGCCGGAGATTAAGTATACT
    CAAAGCAAACAACATATTGAGTCACTAGTTGAATTACAGCTTGAAATATTGGAAAATGTA
    AAAAACAATGTAAAAATAGGTGGCGAAATCATCTATTCAACATGTACAATTGAGCAACTA
    GAAAATGAAAACGTGATTTATACGTTTTTGAAAAATAATAAAAACTTCGAATTTGAACCG
    TTTCAACATCCGATAACTGGAGAGTTGGTCAAAACGTTACAAATCATGCCGCAAGACTTT
    AATTCAGATGGATTCTTTATCACTAAGATAAAAAGAAAGGACAATTAG
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    900
    960
    1020
    1080
    1140
    1200
    1260
    1308

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SAUSA300_RS06010 [old locus tag: SAUSA300_1110 ]
  • symbol: SAUSA300_RS06010
  • description: 16S rRNA (cytosine(967)-C(5))-methyltransferase
  • length: 435
  • theoretical pI: 5.97329
  • theoretical MW: 50113
  • GRAVY: -0.364368

Function[edit | edit source]

  • reaction:
    EC 2.1.1.176?  ExPASy
    16S rRNA (cytosine967-C5)-methyltransferase S-adenosyl-L-methionine + cytosine967 in 16S rRNA = S-adenosyl-L-homocysteine + 5-methylcytosine967 in 16S rRNA
  • TIGRFAM:
    Genetic information processing Protein synthesis tRNA and rRNA base modification 16S rRNA (cytosine(967)-C(5))-methyltransferase (TIGR00563; EC 2.1.1.176; HMM-score: 394)
    and 12 more
    Genetic information processing Protein synthesis tRNA and rRNA base modification NOL1/NOP2/sun family putative RNA methylase (TIGR00446; EC 2.1.1.-; HMM-score: 152.1)
    Genetic information processing Transcription Transcription factors transcription antitermination factor NusB (TIGR01951; HMM-score: 57.4)
    Genetic information processing Protein synthesis Ribosomal proteins: synthesis and modification protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific (TIGR03533; EC 2.1.1.-; HMM-score: 25.2)
    Genetic information processing Protein fate Protein modification and repair protein-(glutamine-N5) methyltransferase, release factor-specific (TIGR03534; EC 2.1.1.-; HMM-score: 18.5)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Heme, porphyrin, and cobalamin precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit (TIGR02469; EC 2.1.1.132; HMM-score: 17.2)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Menaquinone and ubiquinone demethylmenaquinone methyltransferase (TIGR02752; EC 2.1.1.163; HMM-score: 17.2)
    Genetic information processing Protein synthesis tRNA and rRNA base modification N2,N2-dimethylguanosine tRNA methyltransferase (TIGR00308; EC 2.1.1.-; HMM-score: 16.8)
    Genetic information processing Protein fate Protein modification and repair methyltransferase, HemK family (TIGR00536; HMM-score: 16.7)
    Signal transduction Regulatory functions DNA interactions biotin operon repressor (TIGR00122; HMM-score: 13.4)
    Genetic information processing Protein fate Protein modification and repair protein-L-isoaspartate O-methyltransferase (TIGR00080; EC 2.1.1.77; HMM-score: 13.3)
    Genetic information processing Protein synthesis tRNA and rRNA base modification ribosomal RNA large subunit methyltransferase J (TIGR00438; EC 2.1.1.166; HMM-score: 12.4)
    methyltransferase, FxLD system (TIGR04364; HMM-score: 10.5)
  • TheSEED:
  • PFAM:
    NADP_Rossmann (CL0063) Methyltr_RsmB-F; 16S rRNA methyltransferase RsmB/F (PF01189; HMM-score: 175.8)
    and 9 more
    NusB (CL0633) NusB; NusB family (PF01029; HMM-score: 108.2)
    NADP_Rossmann (CL0063) Methyltransf_31; Methyltransferase domain (PF13847; HMM-score: 33.4)
    FtsJ; FtsJ-like methyltransferase (PF01728; HMM-score: 17.5)
    DUF938; Protein of unknown function (DUF938) (PF06080; HMM-score: 14.4)
    DUF2431; Domain of unknown function (DUF2431) (PF10354; HMM-score: 14.4)
    Ubiquitin (CL0072) NLE; NLE (NUC135) domain (PF08154; HMM-score: 14)
    NADP_Rossmann (CL0063) Methyltransf_4; Putative methyltransferase (PF02390; HMM-score: 13.4)
    Ubie_methyltran; ubiE/COQ5 methyltransferase family (PF01209; HMM-score: 12.6)
    TRM; N2,N2-dimethylguanosine tRNA methyltransferase (PF02005; HMM-score: 12.2)

Structure, modifications & interactions[edit | edit source]

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.002253
    • TAT(Tat/SPI): 0.000171
    • LIPO(Sec/SPII): 0.000532
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

  • GI: 446494382 NCBI
  • RefSeq: WP_000572236 NCBI
  • UniProt:

Protein sequence[edit | edit source]

  • MIENVRSLAFDTIQDILNEGAYSNLRINEVLSENELNAMDKALFTEIVYGTVKRKYTLDFYLKPFVKTKIKAWVRQLLWMSIYQYVYLDKVPNHAIINEAVEIAKERGGYHNGNVVNGILRTMMRSDLPDFNEIADPKKRMAIEYSMPKWIIDHWATHYGLEETETILQSFLETTSTTVRANLTRASLDDIIEKLQDEGYDVEKDHDLPYCLHIGGQPIIHSRSFKDGFVSIQDKSSMFVAHIMNVDRHDHVLDACSAPGGKACHIAEVLMPEGQVDASDIHDHKIDLINFNIKKLRLTNIKAFQYDATKPYDKTYDKILVDAPCSGLGVMRHKPEIKYTQSKQHIESLVELQLEILENVKNNVKIGGEIIYSTCTIEQLENENVIYTFLKNNKNFEFEPFQHPITGELVKTLQIMPQDFNSDGFFITKIKRKDN

Experimental data[edit | edit source]

  • experimentally validated: no data available

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

  1. 1.00 1.01 1.02 1.03 1.04 1.05 1.06 1.07 1.08 1.09 1.10 1.11 1.12 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
    Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
    J Proteome Res: 2011, 10(3);1139-50
    [PubMed:21166474] [WorldCat.org] [DOI] (I p)

Relevant publications[edit | edit source]