From AureoWiki
Jump to navigation Jump to search

NCBI: 02-MAR-2017

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_RS06935 [old locus tag: SAUSA300_1277 ]
  • pan locus tag?: SAUPAN003789000
  • symbol: SAUSA300_RS06935
  • pan gene symbol?: —
  • synonym:
  • product: hypothetical protein

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SAUSA300_RS06935 [old locus tag: SAUSA300_1277 ]
  • symbol: SAUSA300_RS06935
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 1405254..1405598
  • length: 345
  • essential: unknown other strains

⊟Accession numbers[edit | edit source]

⊟Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    ATGACATTATTCGATATGCCTAATTATTTATGGATCACAACATTAATAATGATTTTATTA
    ACAATATTCTGTTGCTTAGTTTTAAATAAATGGTTTGTATCTGCAGTAATTACATTTGTT
    ATATTAGGTGTGCTTGCATTTTTTATTCCAAATTTTCAAGATATAAAATATCAACCATTA
    TTAGGATACGCTGCATTTTTAGCGATTATGAGTTTATTAATTAGTTTTCTATTATGGTAT
    TTTACTAGAAATTGGCGTAAAGAAAGAAAAGCGCGTAAATTAGAAAAGCAAATTGAAAAA
    TACGGCTATGAGGGCGCTGAACTTCGCCGTAAAGATAAAAAATAA
    60
    120
    180
    240
    300
    345

⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: SAUSA300_RS06935 [old locus tag: SAUSA300_1277 ]
  • symbol: SAUSA300_RS06935
  • description: hypothetical protein
  • length: 114
  • theoretical pI: 10.156
  • theoretical MW: 13657.4
  • GRAVY: 0.431579

⊟Function[edit | edit source]

  • TIGRFAM:
    Cellular processes Cellular processes Pathogenesis type VI secretion protein IcmF (TIGR03348; HMM-score: 14.7)
    and 3 more
    exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase (TIGR03025; HMM-score: 11.4)
    Metabolism Transport and binding proteins Unknown substrate AspT/YidE/YbjL antiporter duplication domain (TIGR01625; HMM-score: 11)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking preprotein translocase, YajC subunit (TIGR00739; HMM-score: 9.1)
  • TheSEED: see SAUSA300_1277
  • PFAM:
    no clan defined DUF6688; DUF6688 N-terminal domain (PF20394; HMM-score: 22.4)
    and 21 more
    GPCR_A (CL0192) 7TMR-DISM_7TM; 7TM diverse intracellular signalling (PF07695; HMM-score: 17.2)
    no clan defined DUF3611; Protein of unknown function (DUF3611) (PF12263; HMM-score: 15.6)
    SUa-2TM; SMODS- and Ubiquitin system-associated 2TM effector domain (PF18179; HMM-score: 15.6)
    TMEM238; TMEM238 protein family (PF15125; HMM-score: 14.8)
    DUF2070; Predicted membrane protein (DUF2070) (PF09843; HMM-score: 14.4)
    LysE (CL0292) NicO; High-affinity nickel-transport protein (PF03824; HMM-score: 14)
    ThrE (CL0470) ThrE; Putative threonine/serine exporter (PF06738; HMM-score: 13.6)
    no clan defined DUF4381; Domain of unknown function (DUF4381) (PF14316; HMM-score: 13.4)
    LapA_dom; Lipopolysaccharide assembly protein A domain (PF06305; HMM-score: 13.3)
    DUF3149; Protein of unknown function (DUF3149) (PF11346; HMM-score: 13.3)
    O-anti_assembly (CL0499) Wzy_C; O-Antigen ligase (PF04932; HMM-score: 13.2)
    NADP_Rossmann (CL0063) CoA_binding_3; CoA-binding domain (PF13727; HMM-score: 12.2)
    no clan defined MENTAL; Cholesterol-capturing domain (PF10457; HMM-score: 10.3)
    TPR (CL0020) DUF6377; Domain of unknown function (DUF6377) (PF19904; HMM-score: 10)
    no clan defined DUF6199; Family of unknown function (DUF6199) (PF19701; HMM-score: 9.9)
    Halogen_Hydrol; 5-bromo-4-chloroindolyl phosphate hydrolysis protein (PF10112; HMM-score: 9.4)
    Marvel-like (CL0396) MARVEL; Membrane-associating domain (PF01284; HMM-score: 8.9)
    no clan defined E1-E2_ATPase; E1-E2 ATPase (PF00122; HMM-score: 8.6)
    PhoR; Phosphate regulon sensor protein PhoR (PF11808; HMM-score: 7.1)
    SieB; Super-infection exclusion protein B (PF14163; HMM-score: 6.3)
    GT-C (CL0111) YfhO; Bacterial membrane protein YfhO (PF09586; HMM-score: 5.4)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 10
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 3
  • DeepLocPro: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 0.9997
    • Cell wall & surface Score: 0
    • Extracellular Score: 0.0003
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.001183
    • TAT(Tat/SPI): 0.000187
    • LIPO(Sec/SPII): 0.145513
  • predicted transmembrane helices (TMHMM): 3

⊟Accession numbers[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MTLFDMPNYLWITTLIMILLTIFCCLVLNKWFVSAVITFVILGVLAFFIPNFQDIKYQPLLGYAAFLAIMSLLISFLLWYFTRNWRKERKARKLEKQIEKYGYEGAELRRKDKK

⊟Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator:

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

⊟Literature[edit | edit source]

⊟References[edit | edit source]

⊟Relevant publications[edit | edit source]

Retrieved from "http://aureowiki.med.uni-greifswald.de/index.php?title=SAUSA300_RS06935&oldid=97947"