Jump to navigation
Jump to search
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus USA300_FPR3757
- locus tag: SAUSA300_RS07290 [old locus tag: SAUSA300_1337 ]
- pan locus tag?: SAUPAN003904000
- symbol: SAUSA300_RS07290
- pan gene symbol?: gpsB
- synonym:
- product: cell cycle protein GpsB
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAUSA300_RS07290 [old locus tag: SAUSA300_1337 ]
- symbol: SAUSA300_RS07290
- product: cell cycle protein GpsB
- replicon: chromosome
- strand: -
- coordinates: 1502503..1502847
- length: 345
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Location: NC_007793 (1502503..1502847) NCBI
- BioCyc: SAUSA300_RS07290 BioCyc
- MicrobesOnline: see SAUSA300_1337
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGTCAGATGTTTCATTGAAATTATCAGCAAAAGATATTTATGAAAAAGATTTTGAAAAA
ACGATGGCTCGTGGCTATAGAAGAGAAGAAGTAGATGCATTTTTAGATGACATTATTGCT
GATTATCAAAAAATGGCCGATATGAATAATGAAGTTGTAAAATTATCAGAAGAGAATCAT
AAACTTAAAAAAGAATTAGAAGAATTAAGACTACGTGTAGCAACATCAAGACCTCAGGAC
AATAAAAGTTTTTCTTCGAATAATACAACAACAAATACATCTTCAAATAATGTAGATATT
TTAAAACGTATTTCAAACTTAGAAAAAGCTGTATTTGGTAAATAA60
120
180
240
300
345
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAUSA300_RS07290 [old locus tag: SAUSA300_1337 ]
- symbol: SAUSA300_RS07290
- description: cell cycle protein GpsB
- length: 114
- theoretical pI: 5.97468
- theoretical MW: 13150.7
- GRAVY: -0.867544
⊟Function[edit | edit source]
- TIGRFAM: DivIVA domain (TIGR03544; HMM-score: 52.8)and 4 moreCellular processes Sporulation and germination transcription factor, RsfA family (TIGR02894; HMM-score: 16.8)Regulatory functions DNA interactions transcription factor, RsfA family (TIGR02894; HMM-score: 16.8)DivIVA domain repeat protein (TIGR03543; HMM-score: 16.1)SH3 domain protein (TIGR04211; HMM-score: 13.5)
- TheSEED: see SAUSA300_1337
- PFAM: no clan defined DivIVA; DivIVA protein (PF05103; HMM-score: 43.5)and 19 moreYabA; Initiation control protein YabA (PF06156; HMM-score: 24.9)HMMR_C; Hyaluronan mediated motility receptor C-terminal (PF15908; HMM-score: 20)Ax_dynein_light; Axonemal dynein light chain (PF10211; HMM-score: 18)bZIP (CL0018) bZIP_1; bZIP transcription factor (PF00170; HMM-score: 16.7)no clan defined DASH_Spc19; Spc19 (PF08287; HMM-score: 16.6)FtsL (CL0225) DivIC; Septum formation initiator (PF04977; HMM-score: 16.5)Kre28-like_sf (CL0729) Sos7; Kinetochore protein Sos7 (PF20882; HMM-score: 16.3)no clan defined TssO; Type VI secretion system, TssO (PF17561; HMM-score: 15.6)HALZ; Homeobox associated leucine zipper (PF02183; HMM-score: 15)SlyX; SlyX (PF04102; HMM-score: 14.9)Ribo_L29 (CL0346) Ribosomal_L29; Ribosomal L29 protein (PF00831; HMM-score: 14)no clan defined Cnn_1N; Centrosomin N-terminal motif 1 (PF07989; HMM-score: 13.9)TolA_bind_tri; TolA binding protein trimerisation (PF16331; HMM-score: 13.6)TMCO5; TMCO5 family (PF14992; HMM-score: 13.5)DUF2797; Protein of unknown function (DUF2797) (PF10977; HMM-score: 13.1)TPR (CL0020) FAN1_TPR; Fanconi-associated nuclease 1, TPR domain (PF21170; HMM-score: 13.1)no clan defined ABC_tran_CTD; ABC transporter C-terminal domain (PF16326; HMM-score: 12.1)bZIP (CL0018) bZIP_2; Basic region leucine zipper (PF07716; HMM-score: 11.4)no clan defined Herpes_BLRF2; Herpesvirus BLRF2 protein (PF05812; HMM-score: 11.3)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9708
- Cytoplasmic Membrane Score: 0.0155
- Cell wall & surface Score: 0.0027
- Extracellular Score: 0.011
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.001477
- TAT(Tat/SPI): 0.000385
- LIPO(Sec/SPII): 0.000377
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI: 447209064 NCBI
- RefSeq: WP_001286320 NCBI
- UniProt: see SAUSA300_1337
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MSDVSLKLSAKDIYEKDFEKTMARGYRREEVDAFLDDIIADYQKMADMNNEVVKLSEENHKLKKELEELRLRVATSRPQDNKSFSSNNTTTNTSSNNVDILKRISNLEKAVFGK
⊟Experimental data[edit | edit source]
- experimentally validated: data available for COL, NCTC8325
- protein localization: data available for COL
- quantitative data / protein copy number per cell: data available for COL
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]