From AureoWiki
Jump to navigation Jump to search
PangenomeCOLN315NCTC8325NewmanUSA300_FPR3757JSNZ04-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_RS07665 [old locus tag: SAUSA300_1405 ]
  • pan locus tag?: SAUPAN001835000
  • symbol: SAUSA300_RS07665
  • pan gene symbol?:
  • synonym:
  • product: terminase

Additional information (user-provided)[edit | edit source]

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAUSA300_RS07665 [old locus tag: SAUSA300_1405 ]
  • symbol: SAUSA300_RS07665
  • product: terminase
  • replicon: chromosome
  • strand: -
  • coordinates: 1571755..1572060
  • length: 306
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Additional information (user-provided)[edit | edit source]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    ATGAAATTAACAAAAAAACAGCTGAAAGAATATATAGAGGATTATAAAAAATCTGATGAC
    ATATTAATTAATTTGTATATAGAAACGTATGAATTTTATTGTCGGTTAAGAGATGAACTT
    AAAAATAGTGATTTGATGATAGAGCATACAAACAAGGCTGGTGCGAGCAATATTGTTAAG
    AATCCATTAAGCATAGAACTGACAAAAACAGTTCAAACACTAAATAACTTACTCAAGTCT
    ATGGGTTTAACTGCAGCACAAAGAAAAAAGATAGTTCAAGAAGAAGGTGGATTCGGTGAC
    TATTAA
    60
    120
    180
    240
    300
    306


Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SAUSA300_RS07665 [old locus tag: SAUSA300_1405 ]
  • symbol: SAUSA300_RS07665
  • description: terminase
  • length: 101
  • theoretical pI: 8.40935
  • theoretical MW: 11707.4
  • GRAVY: -0.591089

Function[edit | edit source]

  • TIGRFAM:
    Genetic information processing Mobile and extrachromosomal element functions Prophage functions putative phage terminase, small subunit, P27 family (TIGR01558; HMM-score: 33.2)
    and 1 more
    Metabolism Central intermediary metabolism Phosphorus compounds polyphosphate:AMP phosphotransferase (TIGR03708; EC 2.7.4.-; HMM-score: 11)
  • TheSEED: see SAUSA300_1405
  • PFAM:
    no clan defined Terminase_4; Phage terminase, small subunit (PF05119; HMM-score: 49.8)
    and 1 more
    ALIX_LYPXL_bnd; ALIX V-shaped domain binding to HIV (PF13949; HMM-score: 14.9)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9166
    • Cytoplasmic Membrane Score: 0.0011
    • Cell wall & surface Score: 0.0003
    • Extracellular Score: 0.082
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.004573
    • TAT(Tat/SPI): 0.0003
    • LIPO(Sec/SPII): 0.000358
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Additional information (user-provided)[edit | edit source]

Protein sequence[edit | edit source]

  • MKLTKKQLKEYIEDYKKSDDILINLYIETYEFYCRLRDELKNSDLMIEHTNKAGASNIVKNPLSIELTKTVQTLNNLLKSMGLTAAQRKKIVQEEGGFGDY

Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Additional information (user-provided)[edit | edit source]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Additional information (user-provided)[edit | edit source]

Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]


Relevant publications[edit | edit source]