Jump to navigation
Jump to search
PangenomeCOLN315NCTC8325NewmanUSA300_FPR375704-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL0366 [new locus tag: SACOL_RS01840 ]
- pan locus tag?: SAUPAN001835000
- symbol: SACOL0366
- pan gene symbol?: —
- synonym:
- product: prophage L54a, terminase, small subunit
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL0366 [new locus tag: SACOL_RS01840 ]
- symbol: SACOL0366
- product: prophage L54a, terminase, small subunit
- replicon: chromosome
- strand: +
- coordinates: 373932..374237
- length: 306
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3236795 NCBI
- RefSeq: YP_185258 NCBI
- BioCyc:
- MicrobesOnline: 911837 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGAAGTTAACAAAAAAACAGCTAAAAGAATATATAGAAGATTACAAAAAATCTGATGAC
ATATTAATTAATTTGTATATAGAAACATATGAATTTTATTGTCGGTTAAGAGATGAACTT
AAAAATAGTGATTTAATGATAGAGCATACAAACAAGGCTGGTGCGAGCAATATTATTAAG
AATCCATTAAGCATAGAACTGACAAAAACAGTTCAAACACTAAATAACTTACTCAAGTCT
ATGGGTTTAACTGCAGCACAAAGAAAAAAGATAGTTCAAGAAGAAGGTGGATTCGGTGAC
TATTAA60
120
180
240
300
306
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL0366 [new locus tag: SACOL_RS01840 ]
- symbol: SACOL0366
- description: prophage L54a, terminase, small subunit
- length: 101
- theoretical pI: 8.40935
- theoretical MW: 11721.4
- GRAVY: -0.588119
⊟Function[edit | edit source]
- TIGRFAM: Mobile and extrachromosomal element functions Prophage functions putative phage terminase, small subunit, P27 family (TIGR01558; HMM-score: 32.3)and 1 moreCentral intermediary metabolism Phosphorus compounds polyphosphate:AMP phosphotransferase (TIGR03708; EC 2.7.4.-; HMM-score: 10.9)
- TheSEED: Phage terminase small subunit
- PFAM: no clan defined Terminase_4; Phage terminase, small subunit (PF05119; HMM-score: 38.7)and 1 moreALIX_LYPXL_bnd; ALIX V-shaped domain binding to HIV (PF13949; HMM-score: 13)
⊟Structure, modifications & interactions[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
- protein partners:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.004302
- TAT(Tat/SPI): 0.000292
- LIPO(Sec/SPII): 0.000348
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MKLTKKQLKEYIEDYKKSDDILINLYIETYEFYCRLRDELKNSDLMIEHTNKAGASNIIKNPLSIELTKTVQTLNNLLKSMGLTAAQRKKIVQEEGGFGDY
⊟Experimental data[edit | edit source]
- experimentally validated: no data available
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
⊟Relevant publications[edit | edit source]