Jump to navigation
Jump to search
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus USA300_FPR3757
- locus tag: SAUSA300_RS07725 [old locus tag: SAUSA300_1416 ]
- pan locus tag?: SAUPAN001475000
- symbol: SAUSA300_RS07725
- pan gene symbol?: —
- synonym:
- product: DUF1381 domain-containing protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAUSA300_RS07725 [old locus tag: SAUSA300_1416 ]
- symbol: SAUSA300_RS07725
- product: DUF1381 domain-containing protein
- replicon: chromosome
- strand: -
- coordinates: 1579047..1579253
- length: 207
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Location: NC_007793 (1579047..1579253) NCBI
- BioCyc: SAUSA300_RS07725 BioCyc
- MicrobesOnline: see SAUSA300_1416
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181GTGACGCAATACTTAGTCACAACATTCAAAGATTCAACAGGACGCAAGCATACACACATA
ACTAAAGCTAAAAGCAATCAAAGGTTTACAGTTGTTGAGGCAGAGAGTAAAGAAGAAGCT
GAGCGCAAATACGAGGCACAAGTTAAAAGAGATGCAGTTATTAAAGTGGGTCAGTTATTT
GAAAATATAAGGGAGTGTGGGAAATGA60
120
180
207
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAUSA300_RS07725 [old locus tag: SAUSA300_1416 ]
- symbol: SAUSA300_RS07725
- description: DUF1381 domain-containing protein
- length: 68
- theoretical pI: 9.98317
- theoretical MW: 7888.9
- GRAVY: -0.926471
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED: see SAUSA300_1416
- PFAM: no clan defined DUF1381; Protein of unknown function (DUF1381) (PF07129; HMM-score: 78.7)and 2 moreDUF7686; Domain of unknown function (DUF7686) (PF24735; HMM-score: 14.1)DpnD-PcfM; DpnD/PcfM-like protein (PF14207; HMM-score: 13.9)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9445
- Cytoplasmic Membrane Score: 0.0015
- Cell wall & surface Score: 0.001
- Extracellular Score: 0.0529
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.007018
- TAT(Tat/SPI): 0.000664
- LIPO(Sec/SPII): 0.002214
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI: 446117939 NCBI
- RefSeq: WP_000195794 NCBI
- UniProt: see SAUSA300_1416
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MTQYLVTTFKDSTGRKHTHITKAKSNQRFTVVEAESKEEAERKYEAQVKRDAVIKVGQLFENIRECGK
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]