From AureoWiki
Jump to navigation Jump to search

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_RS11835 [old locus tag: SAUSA300_2148 ]
  • pan locus tag?: SAUPAN005584000
  • symbol: SAUSA300_RS11835
  • pan gene symbol?:
  • synonym:
  • product: alpha/beta hydrolase

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAUSA300_RS11835 [old locus tag: SAUSA300_2148 ]
  • symbol: SAUSA300_RS11835
  • product: alpha/beta hydrolase
  • replicon: chromosome
  • strand: -
  • coordinates: 2325236..2326120
  • length: 885
  • essential: unknown

Accession numbers[edit | edit source]

  • Location: NC_007793 (2325236..2326120) NCBI
  • BioCyc:
  • MicrobesOnline:

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    ATGGGAGTTAAAAGTGTGAAGAAAATTTTTGTAATTATTACGACATTGTTAGCGGTCGCT
    ATTATTATAGGCTCTATTATTATGGTGGTGTTTAGTCAACGACAGGCACAAACATTTAAA
    ATACAACAACAGCAATTTGTTAAAAAGCCAATTCCAACATTGTTCTTACATGGATTTGGT
    GGTAGTGCCAATTCTGAAAAGTTTATGGTGAAGCAAGCAGAAAAAAGAGGGGTAACTAAA
    GATATCATCACTGCTTACGTTTCAAAGGATGGTGCAGTGACATTTAAAGGGAAACTAAGA
    AAAGATGCAGTGAATCCTATTGTGAAAATTGAACTTGAAAATAACAGACAAGGCTATTTG
    GATAAGAATGCTGCGTGGTTTAAAAATGTACTGACTAAGTTACAATCTGAATACAATTTC
    GATAAATTCAACTTTGTCGGTCACTCAATGGGGAACTTAACATTTGCACAATATATGATG
    ACATATGGTAACGACAAGTCACTGCCACAGTTAAACAAACAAGTGAATATTGCAGGGACA
    TTTAATGGTGTTTTAAATATGAATGAAGATGTCAATGAAATTACAGTTGATAAAGATGGT
    AAACCAAGTCGAATGAATCAACCTTATCAGCAATTACGCGTGCTAAAAGATATTTATAAA
    GGTAAAGGTATCGAAGTGCTAAATATTTATGGGGATTTGAAAGATGGTACACATTCAGAC
    GGCAGAGTGTCTAATAGTTCTTCGAAATCATTAAAATATTTACTGGGAAATAGTCCGAAA
    AGTTATCGAGAATCTAAATATGAAGGTGAGCCTGCACAACATAGTCAGCTTCATGAGAAT
    GAAAATGTTGCTAATGAGTTAATCGACTTCTTATGGAAAAAATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    885

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SAUSA300_RS11835 [old locus tag: SAUSA300_2148 ]
  • symbol: SAUSA300_RS11835
  • description: alpha/beta hydrolase
  • length: 294
  • theoretical pI: 10.1578
  • theoretical MW: 33185.9
  • GRAVY: -0.437415

Function[edit | edit source]

  • TIGRFAM:
  • TheSEED:
  • PFAM:
    AB_hydrolase (CL0028) DUF915; Alpha/beta hydrolase of unknown function (DUF915) (PF06028; HMM-score: 344.1)
    and 7 more
    Abhydrolase_1; alpha/beta hydrolase fold (PF00561; HMM-score: 16)
    DUF676; Putative serine esterase (DUF676) (PF05057; HMM-score: 15.7)
    no clan defined DAG1; Dystroglycan (Dystrophin-associated glycoprotein 1) (PF05454; HMM-score: 13.6)
    AB_hydrolase (CL0028) DUF900; Alpha/beta hydrolase of unknown function (DUF900) (PF05990; HMM-score: 12.1)
    no clan defined DUF3671; Protein of unknown function (PF12420; HMM-score: 11.8)
    AB_hydrolase (CL0028) Hydrolase_4; Serine aminopeptidase, S33 (PF12146; HMM-score: 11.6)
    no clan defined DUF1461; Protein of unknown function (DUF1461) (PF07314; HMM-score: 10.5)

Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helix: 1
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.257059
    • TAT(Tat/SPI): 0.001852
    • LIPO(Sec/SPII): 0.018251
  • predicted transmembrane helices (TMHMM): 1

Accession numbers[edit | edit source]

  • GI:
  • RefSeq: WP_001797631 NCBI
  • UniProt:

Protein sequence[edit | edit source]

  • MGVKSVKKIFVIITTLLAVAIIIGSIIMVVFSQRQAQTFKIQQQQFVKKPIPTLFLHGFGGSANSEKFMVKQAEKRGVTKDIITAYVSKDGAVTFKGKLRKDAVNPIVKIELENNRQGYLDKNAAWFKNVLTKLQSEYNFDKFNFVGHSMGNLTFAQYMMTYGNDKSLPQLNKQVNIAGTFNGVLNMNEDVNEITVDKDGKPSRMNQPYQQLRVLKDIYKGKGIEVLNIYGDLKDGTHSDGRVSNSSSKSLKYLLGNSPKSYRESKYEGEPAQHSQLHENENVANELIDFLWKK

Experimental data[edit | edit source]

  • experimentally validated: no data available

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]