Jump to navigation
Jump to search
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus USA300_FPR3757
- locus tag: SAUSA300_RS13330 [old locus tag: SAUSA300_2407 ]
- pan locus tag?: SAUPAN006023000
- symbol: SAUSA300_RS13330
- pan gene symbol?: cntF
- synonym:
- product: ABC transporter ATP-binding protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAUSA300_RS13330 [old locus tag: SAUSA300_2407 ]
- symbol: SAUSA300_RS13330
- product: ABC transporter ATP-binding protein
- replicon: chromosome
- strand: -
- coordinates: 2592385..2593134
- length: 750
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Location: NC_007793 (2592385..2593134) NCBI
- BioCyc: SAUSA300_RS13330 BioCyc
- MicrobesOnline: see SAUSA300_2407
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481
541
601
661
721ATGATTAAAATTAAAGATGTTGAAAAGTCATATCAAAGCGCACATGTTTTTAAGCGTCGT
CGAACACCTATCGTGAAAGGTGTGTCATTTGAGTGTCCAATCGGTGCGACGATTGCGATT
ATCGGAGAAAGTGGTAGCGGTAAATCGACGTTGAGTCGTATGATATTAGGTATTGAGAAA
CCGGATAAAGGTTGTGTAACCTTAAATGATCAACCGATGCATAAGAAGAAAGTGAGACGT
CATCAAATTGGTGCTGTATTTCAAGATTATACGTCATCATTACATCCATTTCAGACTGTT
AGAGAAATCTTATTTGAAGTGATGTGTCAATGTGATGGACAACCTAAAGAAGTTATGGAA
GTCCAAGCAATTACATTGTTGGAAGAAGTCGGTCTATCTAAGGCATACATGGATAAATAT
CCTAATATGTTATCAGGTGGAGAGGCGCAACGTGTTGCGATTGCGCGTGCAATATGTATT
AACCCTAAATATATTTTGTTTGATGAAGCCATTAGTTCACTCGACATGTCAATTCAAACA
CAAATATTAGATTTATTGATTCATTTACGTGAAACGCGTCAGTTGAGTTATATTTTTATC
ACACATGATATTCAAGCTGCCACGTATTTATGTGATCAATTAATTATTTTTAAAAACGGA
AAAATAGAAGAACAAATTCCGACAAGCGCATTGCATAAAAGTGACAATGCTTATACAAGA
GAATTAATAGAAAAACAACTATCATTCTAA60
120
180
240
300
360
420
480
540
600
660
720
750
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAUSA300_RS13330 [old locus tag: SAUSA300_2407 ]
- symbol: SAUSA300_RS13330
- description: ABC transporter ATP-binding protein
- length: 249
- theoretical pI: 8.12738
- theoretical MW: 28179.6
- GRAVY: -0.145382
⊟Function[edit | edit source]
- TIGRFAM: Transport and binding proteins Cations and iron carrying compounds nickel import ATP-binding protein NikE (TIGR02769; EC 3.6.3.24; HMM-score: 215)and 71 moreTransport and binding proteins Cations and iron carrying compounds nickel import ATP-binding protein NikD (TIGR02770; HMM-score: 156.2)Transport and binding proteins Anions sulfate ABC transporter, ATP-binding protein (TIGR00968; EC 3.6.3.25; HMM-score: 153.7)Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04521; EC 3.6.3.-; HMM-score: 150.7)Transport and binding proteins Amino acids, peptides and amines glycine betaine/L-proline transport ATP binding subunit (TIGR01186; HMM-score: 144.3)Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04520; EC 3.6.3.-; HMM-score: 142.5)Transport and binding proteins Anions molybdate ABC transporter, ATP-binding protein (TIGR02142; EC 3.6.3.29; HMM-score: 138)Protein fate Protein and peptide secretion and trafficking lipoprotein releasing system, ATP-binding protein (TIGR02211; EC 3.6.3.-; HMM-score: 135.2)Transport and binding proteins Amino acids, peptides and amines putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein (TIGR03265; HMM-score: 135.1)ectoine/hydroxyectoine ABC transporter, ATP-binding protein EhuA (TIGR03005; HMM-score: 134.8)Transport and binding proteins Anions phosphonate ABC transporter, ATP-binding protein (TIGR02315; EC 3.6.3.28; HMM-score: 133.1)D-methionine ABC transporter, ATP-binding protein (TIGR02314; EC 3.6.3.-; HMM-score: 128)Cellular processes Toxin production and resistance putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 127.2)Transport and binding proteins Unknown substrate putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 127.2)Transport and binding proteins Amino acids, peptides and amines polyamine ABC transporter, ATP-binding protein (TIGR01187; EC 3.6.3.31; HMM-score: 125.7)Transport and binding proteins Anions nitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 120.5)Transport and binding proteins Other nitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 120.5)2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT (TIGR03258; HMM-score: 119.6)Cellular processes Cell division cell division ATP-binding protein FtsE (TIGR02673; HMM-score: 119.5)Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 115.7)Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 115.7)Transport and binding proteins Anions phosphate ABC transporter, ATP-binding protein (TIGR00972; EC 3.6.3.27; HMM-score: 115.3)Transport and binding proteins Other thiamine ABC transporter, ATP-binding protein (TIGR01277; EC 3.6.3.-; HMM-score: 107.8)proposed F420-0 ABC transporter, ATP-binding protein (TIGR03873; HMM-score: 107.4)ABC exporter ATP-binding subunit, DevA family (TIGR02982; HMM-score: 105.5)Transport and binding proteins Amino acids, peptides and amines choline ABC transporter, ATP-binding protein (TIGR03415; HMM-score: 105.4)thiol reductant ABC exporter, CydD subunit (TIGR02857; HMM-score: 102.4)Energy metabolism Methanogenesis methyl coenzyme M reductase system, component A2 (TIGR03269; HMM-score: 102.3)Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 102.2)Transport and binding proteins Other LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 102.2)Transport and binding proteins Cations and iron carrying compounds cobalt ABC transporter, ATP-binding protein (TIGR01166; HMM-score: 99.2)Cellular processes Pathogenesis type I secretion system ATPase (TIGR03375; HMM-score: 98.2)Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR03375; HMM-score: 98.2)Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 96.7)Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 96.7)Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtE (TIGR03410; HMM-score: 96.3)Transport and binding proteins Other daunorubicin resistance ABC transporter, ATP-binding protein (TIGR01188; HMM-score: 96.2)Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01846; HMM-score: 95.6)Transport and binding proteins Carbohydrates, organic alcohols, and acids ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system (TIGR03864; HMM-score: 93.8)thiol reductant ABC exporter, CydC subunit (TIGR02868; HMM-score: 92.9)Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01842; HMM-score: 91)Transport and binding proteins Other antigen peptide transporter 2 (TIGR00958; HMM-score: 90)phosphonate C-P lyase system protein PhnL (TIGR02324; HMM-score: 87.4)ABC transporter, permease/ATP-binding protein (TIGR02204; HMM-score: 86)Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 85.9)Transport and binding proteins Other lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 85.9)Cellular processes Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 82.5)Transport and binding proteins Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 82.5)Protein fate Protein and peptide secretion and trafficking ABC-type bacteriocin transporter (TIGR01193; HMM-score: 79.8)Protein fate Protein modification and repair ABC-type bacteriocin transporter (TIGR01193; HMM-score: 79.8)Transport and binding proteins Other ABC-type bacteriocin transporter (TIGR01193; HMM-score: 79.8)Transport and binding proteins Unknown substrate anchored repeat-type ABC transporter, ATP-binding subunit (TIGR03771; HMM-score: 79.7)gliding motility-associated ABC transporter ATP-binding subunit GldA (TIGR03522; HMM-score: 75)Central intermediary metabolism Phosphorus compounds phosphonate C-P lyase system protein PhnK (TIGR02323; HMM-score: 72.8)Transport and binding proteins Carbohydrates, organic alcohols, and acids glucan exporter ATP-binding protein (TIGR01192; EC 3.6.3.42; HMM-score: 72.2)Protein fate Protein and peptide secretion and trafficking heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 71.6)Transport and binding proteins Other heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 71.6)Transport and binding proteins Other pigment precursor permease (TIGR00955; HMM-score: 70.4)lantibiotic protection ABC transporter, ATP-binding subunit (TIGR03740; HMM-score: 67)Biosynthesis of cofactors, prosthetic groups, and carriers Other FeS assembly ATPase SufC (TIGR01978; HMM-score: 63.4)Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtD (TIGR03411; HMM-score: 60.9)Transport and binding proteins Carbohydrates, organic alcohols, and acids D-xylose ABC transporter, ATP-binding protein (TIGR02633; EC 3.6.3.17; HMM-score: 58.3)ATP-binding cassette protein, ChvD family (TIGR03719; HMM-score: 56.9)Transport and binding proteins Other multi drug resistance-associated protein (MRP) (TIGR00957; HMM-score: 50.3)Transport and binding proteins Other rim ABC transporter (TIGR01257; HMM-score: 48)Transport and binding proteins Carbohydrates, organic alcohols, and acids peroxysomal long chain fatty acyl transporter (TIGR00954; HMM-score: 42.7)Transport and binding proteins Amino acids, peptides and amines cyclic peptide transporter (TIGR01194; HMM-score: 40.5)Transport and binding proteins Other cyclic peptide transporter (TIGR01194; HMM-score: 40.5)DNA metabolism DNA replication, recombination, and repair excinuclease ABC subunit A (TIGR00630; EC 3.1.25.-; HMM-score: 36.9)Transport and binding proteins Anions cystic fibrosis transmembrane conductor regulator (CFTR) (TIGR01271; EC 3.6.3.49; HMM-score: 32)Transport and binding proteins Other pleiotropic drug resistance family protein (TIGR00956; HMM-score: 24.3)Purines, pyrimidines, nucleosides, and nucleotides Salvage of nucleosides and nucleotides uridine kinase (TIGR00235; EC 2.7.1.48; HMM-score: 12.4)
- TheSEED: see SAUSA300_2407
- PFAM: P-loop_NTPase (CL0023) ABC_tran; ABC transporter (PF00005; HMM-score: 113)and 19 moreSMC_N; RecF/RecN/SMC N terminal domain (PF02463; HMM-score: 22.2)AAA_22; AAA domain (PF13401; HMM-score: 20.3)AAA_29; P-loop containing region of AAA domain (PF13555; HMM-score: 17)Sigma54_activat; Sigma-54 interaction domain (PF00158; HMM-score: 15.7)AAA_21; AAA domain, putative AbiEii toxin, Type IV TA system (PF13304; HMM-score: 14.8)NACHT; NACHT domain (PF05729; HMM-score: 14.7)nSTAND3; Novel STAND NTPase 3 (PF20720; HMM-score: 14.7)AAA_16; AAA ATPase domain (PF13191; HMM-score: 14.4)NB-ARC; NB-ARC domain (PF00931; HMM-score: 13.8)DUF87; Helicase HerA, central domain (PF01935; HMM-score: 13.8)RsgA_GTPase; RsgA GTPase (PF03193; HMM-score: 13.2)SbcC_Walker_B; SbcC/RAD50-like, Walker B motif (PF13558; HMM-score: 13.2)DLIC; Dynein light intermediate chain (DLIC) (PF05783; HMM-score: 13.1)AAA_33; AAA domain (PF13671; HMM-score: 13.1)MMR_HSR1; 50S ribosome-binding GTPase (PF01926; HMM-score: 13)G-alpha; G-protein alpha subunit (PF00503; HMM-score: 12.4)AAA_24; AAA domain (PF13479; HMM-score: 12.3)AAA_13; AAA domain (PF13166; HMM-score: 12.2)AAA_23; AAA domain (PF13476; HMM-score: 11.7)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 1.05
- Cytoplasmic Membrane Score: 8.78
- Cellwall Score: 0.08
- Extracellular Score: 0.09
- Internal Helices: 0
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0.0351
- Cytoplasmic Membrane Score: 0.9577
- Cell wall & surface Score: 0.0003
- Extracellular Score: 0.0068
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.029828
- TAT(Tat/SPI): 0.013621
- LIPO(Sec/SPII): 0.003557
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI: 446513171 NCBI
- RefSeq: WP_000590517 NCBI
- UniProt: see SAUSA300_2407
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MIKIKDVEKSYQSAHVFKRRRTPIVKGVSFECPIGATIAIIGESGSGKSTLSRMILGIEKPDKGCVTLNDQPMHKKKVRRHQIGAVFQDYTSSLHPFQTVREILFEVMCQCDGQPKEVMEVQAITLLEEVGLSKAYMDKYPNMLSGGEAQRVAIARAICINPKYILFDEAISSLDMSIQTQILDLLIHLRETRQLSYIFITHDIQAATYLCDQLIIFKNGKIEEQIPTSALHKSDNAYTRELIEKQLSF
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
SAUSA300_RS02850 elongation factor Tu [1] (data from MRSA252)
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
J Proteome Res: 2011, 10(3);1139-50
[PubMed:21166474] [WorldCat.org] [DOI] (I p)