Jump to navigation
Jump to search
NCBI: 03-AUG-2016
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus NCTC8325
- locus tag: SAOUHSC_02763
- pan locus tag?: SAUPAN006023000
- symbol: SAOUHSC_02763
- pan gene symbol?: cntF
- synonym:
- product: peptide ABC transporter ATP-binding protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAOUHSC_02763
- symbol: SAOUHSC_02763
- product: peptide ABC transporter ATP-binding protein
- replicon: chromosome
- strand: -
- coordinates: 2539489..2540238
- length: 750
- essential: no DEG other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3921635 NCBI
- RefSeq: YP_501222 NCBI
- BioCyc: G1I0R-2603 BioCyc
- MicrobesOnline: 1291193 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481
541
601
661
721ATGATTAAAATTAAAGATGTTGAAAAGTCATATCAAAGCGCACATGTTTTTAAGCGTCGT
CGAACACCTATCGTGAAAGGTGTGTCATTTGAGTGTCCAATCGGTGCGACGATTGCGATT
ATCGGAGAAAGTGGTAGCGGTAAATCGACGTTGAGTCGTATGATATTAGGTATTGAGAAA
CCGGATAAAGGTTGTGTAACCTTAAATGATCAACCGATGCATAAGAAGAAAGTGAGACGT
CATCAAATTGGTGCTGTATTTCAAGATTATACGTCATCATTACATCCATTTCAGACTGTT
AGAGAAATCTTATTTGAAGTGATGTGTCAATGTGATGGACAACCTAAAGAAGTTATGGAA
GTCCAAGCAATTACATTGTTGGAAGAAGTCGGTCTATCTAAGGCATACATGGATAAATAT
CCTAATATGTTATCAGGTGGAGAGGCGCAACGTGTTGCGATTGCGCGTGCAATATGTATT
AACCCTAAATATATTTTGTTTGATGAAGCCATTAGTTCACTCGACATGTCAATTCAAACA
CAAATATTAGATTTATTGATTCATTTACGTGAAACGCGTCAGTTGAGTTATATTTTTATC
ACACATGATATTCAAGCTGCCACGTATTTATGTGATCAATTAATTATTTTTAAAAACGGA
AAAATAGAAGAACAAATTCCGACAAGCGCATTGCATAAAAGTGACAATGCTTATACAAGA
GAATTAATAGAAAAACAACTATCATTCTAA60
120
180
240
300
360
420
480
540
600
660
720
750
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAOUHSC_02763
- symbol: SAOUHSC_02763
- description: peptide ABC transporter ATP-binding protein
- length: 249
- theoretical pI: 8.12738
- theoretical MW: 28179.6
- GRAVY: -0.145382
⊟Function[edit | edit source]
- TIGRFAM: Transport and binding proteins Cations and iron carrying compounds nickel import ATP-binding protein NikE (TIGR02769; EC 3.6.3.24; HMM-score: 215)and 71 moreTransport and binding proteins Cations and iron carrying compounds nickel import ATP-binding protein NikD (TIGR02770; HMM-score: 156.2)Transport and binding proteins Anions sulfate ABC transporter, ATP-binding protein (TIGR00968; EC 3.6.3.25; HMM-score: 153.7)Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04521; EC 3.6.3.-; HMM-score: 150.7)Transport and binding proteins Amino acids, peptides and amines glycine betaine/L-proline transport ATP binding subunit (TIGR01186; HMM-score: 144.3)Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04520; EC 3.6.3.-; HMM-score: 142.5)Transport and binding proteins Anions molybdate ABC transporter, ATP-binding protein (TIGR02142; EC 3.6.3.29; HMM-score: 138)Protein fate Protein and peptide secretion and trafficking lipoprotein releasing system, ATP-binding protein (TIGR02211; EC 3.6.3.-; HMM-score: 135.2)Transport and binding proteins Amino acids, peptides and amines putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein (TIGR03265; HMM-score: 135.1)ectoine/hydroxyectoine ABC transporter, ATP-binding protein EhuA (TIGR03005; HMM-score: 134.8)Transport and binding proteins Anions phosphonate ABC transporter, ATP-binding protein (TIGR02315; EC 3.6.3.28; HMM-score: 133.1)D-methionine ABC transporter, ATP-binding protein (TIGR02314; EC 3.6.3.-; HMM-score: 128)Cellular processes Toxin production and resistance putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 127.2)Transport and binding proteins Unknown substrate putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 127.2)Transport and binding proteins Amino acids, peptides and amines polyamine ABC transporter, ATP-binding protein (TIGR01187; EC 3.6.3.31; HMM-score: 125.7)Transport and binding proteins Anions nitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 120.5)Transport and binding proteins Other nitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 120.5)2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT (TIGR03258; HMM-score: 119.6)Cellular processes Cell division cell division ATP-binding protein FtsE (TIGR02673; HMM-score: 119.5)Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 115.7)Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 115.7)Transport and binding proteins Anions phosphate ABC transporter, ATP-binding protein (TIGR00972; EC 3.6.3.27; HMM-score: 115.3)Transport and binding proteins Other thiamine ABC transporter, ATP-binding protein (TIGR01277; EC 3.6.3.-; HMM-score: 107.8)proposed F420-0 ABC transporter, ATP-binding protein (TIGR03873; HMM-score: 107.4)ABC exporter ATP-binding subunit, DevA family (TIGR02982; HMM-score: 105.5)Transport and binding proteins Amino acids, peptides and amines choline ABC transporter, ATP-binding protein (TIGR03415; HMM-score: 105.4)thiol reductant ABC exporter, CydD subunit (TIGR02857; HMM-score: 102.4)Energy metabolism Methanogenesis methyl coenzyme M reductase system, component A2 (TIGR03269; HMM-score: 102.3)Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 102.2)Transport and binding proteins Other LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 102.2)Transport and binding proteins Cations and iron carrying compounds cobalt ABC transporter, ATP-binding protein (TIGR01166; HMM-score: 99.2)Cellular processes Pathogenesis type I secretion system ATPase (TIGR03375; HMM-score: 98.2)Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR03375; HMM-score: 98.2)Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 96.7)Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 96.7)Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtE (TIGR03410; HMM-score: 96.3)Transport and binding proteins Other daunorubicin resistance ABC transporter, ATP-binding protein (TIGR01188; HMM-score: 96.2)Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01846; HMM-score: 95.6)Transport and binding proteins Carbohydrates, organic alcohols, and acids ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system (TIGR03864; HMM-score: 93.8)thiol reductant ABC exporter, CydC subunit (TIGR02868; HMM-score: 92.9)Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01842; HMM-score: 91)Transport and binding proteins Other antigen peptide transporter 2 (TIGR00958; HMM-score: 90)phosphonate C-P lyase system protein PhnL (TIGR02324; HMM-score: 87.4)ABC transporter, permease/ATP-binding protein (TIGR02204; HMM-score: 86)Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 85.9)Transport and binding proteins Other lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 85.9)Cellular processes Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 82.5)Transport and binding proteins Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 82.5)Protein fate Protein and peptide secretion and trafficking ABC-type bacteriocin transporter (TIGR01193; HMM-score: 79.8)Protein fate Protein modification and repair ABC-type bacteriocin transporter (TIGR01193; HMM-score: 79.8)Transport and binding proteins Other ABC-type bacteriocin transporter (TIGR01193; HMM-score: 79.8)Transport and binding proteins Unknown substrate anchored repeat-type ABC transporter, ATP-binding subunit (TIGR03771; HMM-score: 79.7)gliding motility-associated ABC transporter ATP-binding subunit GldA (TIGR03522; HMM-score: 75)Central intermediary metabolism Phosphorus compounds phosphonate C-P lyase system protein PhnK (TIGR02323; HMM-score: 72.8)Transport and binding proteins Carbohydrates, organic alcohols, and acids glucan exporter ATP-binding protein (TIGR01192; EC 3.6.3.42; HMM-score: 72.2)Protein fate Protein and peptide secretion and trafficking heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 71.6)Transport and binding proteins Other heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 71.6)Transport and binding proteins Other pigment precursor permease (TIGR00955; HMM-score: 70.4)lantibiotic protection ABC transporter, ATP-binding subunit (TIGR03740; HMM-score: 67)Biosynthesis of cofactors, prosthetic groups, and carriers Other FeS assembly ATPase SufC (TIGR01978; HMM-score: 63.4)Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtD (TIGR03411; HMM-score: 60.9)Transport and binding proteins Carbohydrates, organic alcohols, and acids D-xylose ABC transporter, ATP-binding protein (TIGR02633; EC 3.6.3.17; HMM-score: 58.3)ATP-binding cassette protein, ChvD family (TIGR03719; HMM-score: 56.9)Transport and binding proteins Other multi drug resistance-associated protein (MRP) (TIGR00957; HMM-score: 50.3)Transport and binding proteins Other rim ABC transporter (TIGR01257; HMM-score: 48)Transport and binding proteins Carbohydrates, organic alcohols, and acids peroxysomal long chain fatty acyl transporter (TIGR00954; HMM-score: 42.7)Transport and binding proteins Amino acids, peptides and amines cyclic peptide transporter (TIGR01194; HMM-score: 40.5)Transport and binding proteins Other cyclic peptide transporter (TIGR01194; HMM-score: 40.5)DNA metabolism DNA replication, recombination, and repair excinuclease ABC subunit A (TIGR00630; EC 3.1.25.-; HMM-score: 36.9)Transport and binding proteins Anions cystic fibrosis transmembrane conductor regulator (CFTR) (TIGR01271; EC 3.6.3.49; HMM-score: 32)Transport and binding proteins Other pleiotropic drug resistance family protein (TIGR00956; HMM-score: 24.3)Purines, pyrimidines, nucleosides, and nucleotides Salvage of nucleosides and nucleotides uridine kinase (TIGR00235; EC 2.7.1.48; HMM-score: 12.4)
- TheSEED :
- Oligopeptide transporter putative ATPase domain
- PFAM: P-loop_NTPase (CL0023) ABC_tran; ABC transporter (PF00005; HMM-score: 113)and 19 moreSMC_N; RecF/RecN/SMC N terminal domain (PF02463; HMM-score: 22.2)AAA_22; AAA domain (PF13401; HMM-score: 20.3)AAA_29; P-loop containing region of AAA domain (PF13555; HMM-score: 17)Sigma54_activat; Sigma-54 interaction domain (PF00158; HMM-score: 15.7)AAA_21; AAA domain, putative AbiEii toxin, Type IV TA system (PF13304; HMM-score: 14.8)NACHT; NACHT domain (PF05729; HMM-score: 14.7)nSTAND3; Novel STAND NTPase 3 (PF20720; HMM-score: 14.7)AAA_16; AAA ATPase domain (PF13191; HMM-score: 14.4)NB-ARC; NB-ARC domain (PF00931; HMM-score: 13.8)DUF87; Helicase HerA, central domain (PF01935; HMM-score: 13.8)RsgA_GTPase; RsgA GTPase (PF03193; HMM-score: 13.2)SbcC_Walker_B; SbcC/RAD50-like, Walker B motif (PF13558; HMM-score: 13.2)DLIC; Dynein light intermediate chain (DLIC) (PF05783; HMM-score: 13.1)AAA_33; AAA domain (PF13671; HMM-score: 13.1)MMR_HSR1; 50S ribosome-binding GTPase (PF01926; HMM-score: 13)G-alpha; G-protein alpha subunit (PF00503; HMM-score: 12.4)AAA_24; AAA domain (PF13479; HMM-score: 12.3)AAA_13; AAA domain (PF13166; HMM-score: 12.2)AAA_23; AAA domain (PF13476; HMM-score: 11.7)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 1.05
- Cytoplasmic Membrane Score: 8.78
- Cellwall Score: 0.08
- Extracellular Score: 0.09
- Internal Helices: 0
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0.0351
- Cytoplasmic Membrane Score: 0.9577
- Cell wall & surface Score: 0.0003
- Extracellular Score: 0.0068
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: -1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.029828
- TAT(Tat/SPI): 0.013621
- LIPO(Sec/SPII): 0.003557
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MIKIKDVEKSYQSAHVFKRRRTPIVKGVSFECPIGATIAIIGESGSGKSTLSRMILGIEKPDKGCVTLNDQPMHKKKVRRHQIGAVFQDYTSSLHPFQTVREILFEVMCQCDGQPKEVMEVQAITLLEEVGLSKAYMDKYPNMLSGGEAQRVAIARAICINPKYILFDEAISSLDMSIQTQILDLLIHLRETRQLSYIFITHDIQAATYLCDQLIIFKNGKIEEQIPTSALHKSDNAYTRELIEKQLSF
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
SAOUHSC_00530 elongation factor Tu [1] (data from MRSA252)
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: SAOUHSC_02762 < SAOUHSC_02763 < SAOUHSC_02764 < SAOUHSC_02765 < SAOUHSC_02766 < SAOUHSC_02767 < SAOUHSC_02768 < SAOUHSC_02769predicted SigA promoter [2] : S1073 < SAOUHSC_02762 < SAOUHSC_02763 < SAOUHSC_02764 < SAOUHSC_02765 < SAOUHSC_02766 < SAOUHSC_02767 < S1074 < SAOUHSC_02768 < S1075 < SAOUHSC_02769 < SAOUHSC_02770 < S1076 < S1077
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: [2]
Multi-gene expression profiles
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
J Proteome Res: 2011, 10(3);1139-50
[PubMed:21166474] [WorldCat.org] [DOI] (I p) - ↑ 2.0 2.1 Ulrike Mäder, Pierre Nicolas, Maren Depke, Jan Pané-Farré, Michel Debarbouille, Magdalena M van der Kooi-Pol, Cyprien Guérin, Sandra Dérozier, Aurelia Hiron, Hanne Jarmer, Aurélie Leduc, Stephan Michalik, Ewoud Reilman, Marc Schaffer, Frank Schmidt, Philippe Bessières, Philippe Noirot, Michael Hecker, Tarek Msadek, Uwe Völker, Jan Maarten van Dijl
Staphylococcus aureus Transcriptome Architecture: From Laboratory to Infection-Mimicking Conditions.
PLoS Genet: 2016, 12(4);e1005962
[PubMed:27035918] [WorldCat.org] [DOI] (I e)
⊟Relevant publications[edit | edit source]
Laetitia Remy, Marie Carrière, Aurélie Derré-Bobillot, Cécilia Martini, Maurizio Sanguinetti, Elise Borezée-Durant
The Staphylococcus aureus Opp1 ABC transporter imports nickel and cobalt in zinc-depleted conditions and contributes to virulence.
Mol Microbiol: 2013, 87(4);730-43
[PubMed:23279021] [WorldCat.org] [DOI] (I p)
