Jump to navigation
Jump to search
NCBI: 03-AUG-2016
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus NCTC8325
- locus tag: SAOUHSC_02764
- pan locus tag?: SAUPAN006024000
- symbol: SAOUHSC_02764
- pan gene symbol?: cntD
- synonym:
- product: peptide ABC transporter ATP-binding protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAOUHSC_02764
- symbol: SAOUHSC_02764
- product: peptide ABC transporter ATP-binding protein
- replicon: chromosome
- strand: -
- coordinates: 2540231..2541046
- length: 816
- essential: no DEG other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3921419 NCBI
- RefSeq: YP_501223 NCBI
- BioCyc: G1I0R-2604 BioCyc
- MicrobesOnline: 1291194 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481
541
601
661
721
781ATGACATTGTTAACAGTTAAACATTTGACGATTACAGATACCTGGACAGATCAACCACTC
GTGAGTGATGTGAATTTTACATTAACTAAGGGTGAAACTTTAGGCGTTATTGGAGAAAGT
GGTAGTGGTAAATCAATCACTTGTAAATCGATTATTGGTTTGAATCCCGAACGACTCGGG
GTGACAGGTGAAATTATCTTTGATGGTACATCAATGTTGTCATTATCTGAATCGCAATTG
AAAAAGTACCGTGGTAAAGACATTGCGATGGTCATGCAACAAGGTAGTCGTGCCTTTGAC
CCATCAACTACTGTCGGTAAACAAATGTTTGAGACTATGAAAGTACATACGTCAATGTCT
ACACAAGAAATTGAAAAGACATTGATTGAATATATGGATTATTTAAGTTTGAAAGATCCT
AAACGTATATTAAAATCATACCCTTACATGTTATCAGGAGGAATGTTACAGCGATTGATG
ATTGCTTTAGCGTTAGCTTTGAAACCAAAGTTAATCATTGCTGATGAGCCGACAACGGCT
TTAGATACAATTACACAATATGATGTACTGGAAGCATTTATAGATATTAAAAAACACTTT
GACTGTGCGATGATTTTCATTTCACATGATTTAACGGTTATTAACAAGATTGCAGACCGT
GTTGTTGTGATGAAAAATGGTCAGCTTATTGAACAAGGGACACGTGAATCAGTCTTGCAT
CATCCAGAACATGTTTATACGAAGTATTTATTATCAACGAAGAAGAAGATTAATGATCAT
TTTAAACATGTGATGAGGGGTGATGTACATGATTAA60
120
180
240
300
360
420
480
540
600
660
720
780
816
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAOUHSC_02764
- symbol: SAOUHSC_02764
- description: peptide ABC transporter ATP-binding protein
- length: 271
- theoretical pI: 7.77588
- theoretical MW: 30468.3
- GRAVY: -0.122878
⊟Function[edit | edit source]
- TIGRFAM: Transport and binding proteins Cations and iron carrying compounds nickel import ATP-binding protein NikD (TIGR02770; HMM-score: 266.1)and 73 moreTransport and binding proteins Cations and iron carrying compounds nickel import ATP-binding protein NikE (TIGR02769; EC 3.6.3.24; HMM-score: 172.7)Transport and binding proteins Amino acids, peptides and amines glycine betaine/L-proline transport ATP binding subunit (TIGR01186; HMM-score: 147.7)Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04521; EC 3.6.3.-; HMM-score: 138)D-methionine ABC transporter, ATP-binding protein (TIGR02314; EC 3.6.3.-; HMM-score: 129.5)Transport and binding proteins Anions phosphate ABC transporter, ATP-binding protein (TIGR00972; EC 3.6.3.27; HMM-score: 128.3)Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04520; EC 3.6.3.-; HMM-score: 121.3)Transport and binding proteins Anions phosphonate ABC transporter, ATP-binding protein (TIGR02315; EC 3.6.3.28; HMM-score: 112.7)ectoine/hydroxyectoine ABC transporter, ATP-binding protein EhuA (TIGR03005; HMM-score: 112.4)Transport and binding proteins Amino acids, peptides and amines choline ABC transporter, ATP-binding protein (TIGR03415; HMM-score: 110.4)Protein fate Protein and peptide secretion and trafficking lipoprotein releasing system, ATP-binding protein (TIGR02211; EC 3.6.3.-; HMM-score: 109.6)Transport and binding proteins Anions molybdate ABC transporter, ATP-binding protein (TIGR02142; EC 3.6.3.29; HMM-score: 104.8)ABC exporter ATP-binding subunit, DevA family (TIGR02982; HMM-score: 104.1)Transport and binding proteins Anions sulfate ABC transporter, ATP-binding protein (TIGR00968; EC 3.6.3.25; HMM-score: 102.8)Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 102)Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 102)Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 100.7)Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 100.7)Transport and binding proteins Amino acids, peptides and amines putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein (TIGR03265; HMM-score: 100.6)Central intermediary metabolism Phosphorus compounds phosphonate C-P lyase system protein PhnK (TIGR02323; HMM-score: 100.1)Cellular processes Toxin production and resistance putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 99.6)Transport and binding proteins Unknown substrate putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 99.6)Energy metabolism Methanogenesis methyl coenzyme M reductase system, component A2 (TIGR03269; HMM-score: 94.7)Cellular processes Cell division cell division ATP-binding protein FtsE (TIGR02673; HMM-score: 94)Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01842; HMM-score: 93.7)Transport and binding proteins Anions nitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 93.1)Transport and binding proteins Other nitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 93.1)Transport and binding proteins Other daunorubicin resistance ABC transporter, ATP-binding protein (TIGR01188; HMM-score: 92.8)Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 90.5)Transport and binding proteins Other lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 90.5)2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT (TIGR03258; HMM-score: 90.4)Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtE (TIGR03410; HMM-score: 88.4)Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 88.3)Transport and binding proteins Other LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 88.3)proposed F420-0 ABC transporter, ATP-binding protein (TIGR03873; HMM-score: 85.9)Cellular processes Pathogenesis type I secretion system ATPase (TIGR03375; HMM-score: 85)Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR03375; HMM-score: 85)Protein fate Protein and peptide secretion and trafficking ABC-type bacteriocin transporter (TIGR01193; HMM-score: 83.4)Protein fate Protein modification and repair ABC-type bacteriocin transporter (TIGR01193; HMM-score: 83.4)Transport and binding proteins Other ABC-type bacteriocin transporter (TIGR01193; HMM-score: 83.4)Transport and binding proteins Amino acids, peptides and amines polyamine ABC transporter, ATP-binding protein (TIGR01187; EC 3.6.3.31; HMM-score: 82)lantibiotic protection ABC transporter, ATP-binding subunit (TIGR03740; HMM-score: 81.1)Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01846; HMM-score: 79.1)ABC transporter, permease/ATP-binding protein (TIGR02204; HMM-score: 78.5)Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtD (TIGR03411; HMM-score: 76.5)thiol reductant ABC exporter, CydD subunit (TIGR02857; HMM-score: 76.1)Cellular processes Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 75.9)Transport and binding proteins Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 75.9)Transport and binding proteins Carbohydrates, organic alcohols, and acids D-xylose ABC transporter, ATP-binding protein (TIGR02633; EC 3.6.3.17; HMM-score: 75.7)Transport and binding proteins Other antigen peptide transporter 2 (TIGR00958; HMM-score: 74)Biosynthesis of cofactors, prosthetic groups, and carriers Other FeS assembly ATPase SufC (TIGR01978; HMM-score: 69.1)Transport and binding proteins Carbohydrates, organic alcohols, and acids ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system (TIGR03864; HMM-score: 69.1)phosphonate C-P lyase system protein PhnL (TIGR02324; HMM-score: 67.7)thiol reductant ABC exporter, CydC subunit (TIGR02868; HMM-score: 67)Transport and binding proteins Cations and iron carrying compounds cobalt ABC transporter, ATP-binding protein (TIGR01166; HMM-score: 66.9)Transport and binding proteins Other pigment precursor permease (TIGR00955; HMM-score: 66)Transport and binding proteins Unknown substrate anchored repeat-type ABC transporter, ATP-binding subunit (TIGR03771; HMM-score: 64.8)Transport and binding proteins Other thiamine ABC transporter, ATP-binding protein (TIGR01277; EC 3.6.3.-; HMM-score: 59.6)gliding motility-associated ABC transporter ATP-binding subunit GldA (TIGR03522; HMM-score: 58.5)Transport and binding proteins Carbohydrates, organic alcohols, and acids glucan exporter ATP-binding protein (TIGR01192; EC 3.6.3.42; HMM-score: 57.1)ATP-binding cassette protein, ChvD family (TIGR03719; HMM-score: 53)Transport and binding proteins Anions cystic fibrosis transmembrane conductor regulator (CFTR) (TIGR01271; EC 3.6.3.49; HMM-score: 45.6)Protein fate Protein and peptide secretion and trafficking heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 38.5)Transport and binding proteins Other heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 38.5)Transport and binding proteins Other multi drug resistance-associated protein (MRP) (TIGR00957; HMM-score: 36.9)Transport and binding proteins Other rim ABC transporter (TIGR01257; HMM-score: 34)Transport and binding proteins Other pleiotropic drug resistance family protein (TIGR00956; HMM-score: 31)Transport and binding proteins Carbohydrates, organic alcohols, and acids peroxysomal long chain fatty acyl transporter (TIGR00954; HMM-score: 26.7)DNA metabolism DNA replication, recombination, and repair excinuclease ABC subunit A (TIGR00630; EC 3.1.25.-; HMM-score: 22.5)Transport and binding proteins Amino acids, peptides and amines oligopeptide/dipeptide ABC transporter, ATP-binding protein, C-terminal domain (TIGR01727; HMM-score: 19.8)Transport and binding proteins Amino acids, peptides and amines cyclic peptide transporter (TIGR01194; HMM-score: 18.9)Transport and binding proteins Other cyclic peptide transporter (TIGR01194; HMM-score: 18.9)Hypothetical proteins Conserved TIGR00162 family protein (TIGR00162; HMM-score: 12.6)rad50 (TIGR00606; HMM-score: 11.1)
- TheSEED :
- Oligopeptide transporter putative ATPase domain
- PFAM: P-loop_NTPase (CL0023) ABC_tran; ABC transporter (PF00005; HMM-score: 98.7)and 6 moreSMC_N; RecF/RecN/SMC N terminal domain (PF02463; HMM-score: 22)no clan defined oligo_HPY; Oligopeptide/dipeptide transporter, C-terminal region (PF08352; HMM-score: 19.5)P-loop_NTPase (CL0023) AAA_22; AAA domain (PF13401; HMM-score: 18.3)ATP-synt_ab; ATP synthase alpha/beta family, nucleotide-binding domain (PF00006; HMM-score: 14.2)DUF87; Helicase HerA, central domain (PF01935; HMM-score: 13.3)no clan defined GMAP; Galanin message associated peptide (GMAP) (PF06540; HMM-score: 12.2)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0.17
- Cytoplasmic Membrane Score: 9.51
- Cellwall Score: 0.16
- Extracellular Score: 0.15
- Internal Helices: 0
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0.1949
- Cytoplasmic Membrane Score: 0.7845
- Cell wall & surface Score: 0.0005
- Extracellular Score: 0.0202
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.023632
- TAT(Tat/SPI): 0.000399
- LIPO(Sec/SPII): 0.001212
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MTLLTVKHLTITDTWTDQPLVSDVNFTLTKGETLGVIGESGSGKSITCKSIIGLNPERLGVTGEIIFDGTSMLSLSESQLKKYRGKDIAMVMQQGSRAFDPSTTVGKQMFETMKVHTSMSTQEIEKTLIEYMDYLSLKDPKRILKSYPYMLSGGMLQRLMIALALALKPKLIIADEPTTALDTITQYDVLEAFIDIKKHFDCAMIFISHDLTVINKIADRVVVMKNGQLIEQGTRESVLHHPEHVYTKYLLSTKKKINDHFKHVMRGDVHD
⊟Experimental data[edit | edit source]
- experimentally validated: PeptideAtlas [1] [2]
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: SAOUHSC_02762 < SAOUHSC_02763 < SAOUHSC_02764 < SAOUHSC_02765 < SAOUHSC_02766 < SAOUHSC_02767 < SAOUHSC_02768 < SAOUHSC_02769predicted SigA promoter [3] : S1073 < SAOUHSC_02762 < SAOUHSC_02763 < SAOUHSC_02764 < SAOUHSC_02765 < SAOUHSC_02766 < SAOUHSC_02767 < S1074 < SAOUHSC_02768 < S1075 < SAOUHSC_02769 < SAOUHSC_02770 < S1076 < S1077
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: [3]
Multi-gene expression profiles
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Maren Depke, Stephan Michalik, Alexander Rabe, Kristin Surmann, Lars Brinkmann, Nico Jehmlich, Jörg Bernhardt, Michael Hecker, Bernd Wollscheid, Zhi Sun, Robert L Moritz, Uwe Völker, Frank Schmidt
A peptide resource for the analysis of Staphylococcus aureus in host-pathogen interaction studies.
Proteomics: 2015, 15(21);3648-61
[PubMed:26224020] [WorldCat.org] [DOI] (I p) - ↑ Stephan Michalik, Maren Depke, Annette Murr, Manuela Gesell Salazar, Ulrike Kusebauch, Zhi Sun, Tanja C Meyer, Kristin Surmann, Henrike Pförtner, Petra Hildebrandt, Stefan Weiss, Laura Marcela Palma Medina, Melanie Gutjahr, Elke Hammer, Dörte Becher, Thomas Pribyl, Sven Hammerschmidt, Eric W Deutsch, Samuel L Bader, Michael Hecker, Robert L Moritz, Ulrike Mäder, Uwe Völker, Frank Schmidt
A global Staphylococcus aureus proteome resource applied to the in vivo characterization of host-pathogen interactions.
Sci Rep: 2017, 7(1);9718
[PubMed:28887440] [WorldCat.org] [DOI] (I e) - ↑ 3.0 3.1 Ulrike Mäder, Pierre Nicolas, Maren Depke, Jan Pané-Farré, Michel Debarbouille, Magdalena M van der Kooi-Pol, Cyprien Guérin, Sandra Dérozier, Aurelia Hiron, Hanne Jarmer, Aurélie Leduc, Stephan Michalik, Ewoud Reilman, Marc Schaffer, Frank Schmidt, Philippe Bessières, Philippe Noirot, Michael Hecker, Tarek Msadek, Uwe Völker, Jan Maarten van Dijl
Staphylococcus aureus Transcriptome Architecture: From Laboratory to Infection-Mimicking Conditions.
PLoS Genet: 2016, 12(4);e1005962
[PubMed:27035918] [WorldCat.org] [DOI] (I e)
⊟Relevant publications[edit | edit source]
Laetitia Remy, Marie Carrière, Aurélie Derré-Bobillot, Cécilia Martini, Maurizio Sanguinetti, Elise Borezée-Durant
The Staphylococcus aureus Opp1 ABC transporter imports nickel and cobalt in zinc-depleted conditions and contributes to virulence.
Mol Microbiol: 2013, 87(4);730-43
[PubMed:23279021] [WorldCat.org] [DOI] (I p)
