Jump to navigation
Jump to search
NCBI: 06-JUL-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus Newman
- locus tag: NWMN_2361 [new locus tag: NWMN_RS13610 ]
- pan locus tag?: SAUPAN006024000
- symbol: opp1D
- pan gene symbol?: cntD
- synonym:
- product: peptide ABC transporter ATP-binding protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: NWMN_2361 [new locus tag: NWMN_RS13610 ]
- symbol: opp1D
- product: peptide ABC transporter ATP-binding protein
- replicon: chromosome
- strand: -
- coordinates: 2598062..2598877
- length: 816
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 5332222 NCBI
- RefSeq: YP_001333395 NCBI
- BioCyc:
- MicrobesOnline: 3707963 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481
541
601
661
721
781ATGACATTGTTAACAGTTAAACATTTGACGATTACAGATACCTGGACAGATCAACCACTC
GTGAGTGATGTGAATTTTACATTAACTAAGGGTGAAACTTTAGGCGTTATTGGAGAAAGT
GGTAGTGGTAAATCAATCACTTGTAAATCGATTATTGGTTTGAATCCCGAACGACTCGGG
GTGACAGGTGAAATTATCTTTGATGGTACATCAATGTTGTCATTATCTGAATCGCAATTG
AAAAAGTACCGTGGTAAAGACATTGCGATGGTCATGCAACAAGGTAGTCGTGCCTTTGAC
CCATCAACTACTGTCGGTAAACAAATGTTTGAGACTATGAAAGTACATACGTCAATGTCT
ACACAAGAAATTGAAAAGACATTGATTGAATATATGGATTATTTAAGTTTGAAAGATCCT
AAACGTATATTAAAATCATACCCTTACATGTTATCAGGAGGAATGTTACAGCGATTGATG
ATTGCTTTAGCGTTAGCTTTGAAACCAAAGTTAATCATTGCTGATGAGCCGACAACGGCT
TTAGATACAATTACACAATATGATGTACTGGAAGCATTTATAGATATTAAAAAACACTTT
GACTGTGCGATGATTTTCATTTCACATGATTTAACGGTTATTAACAAGATTGCAGACCGT
GTTGTTGTGATGAAAAATGGTCAGCTTATTGAACAAGGGACACGTGAATCAGTCTTGCAT
CATCCAGAACATGTTTATACGAAGTATTTATTATCAACGAAGAAGAAGATTAATGATCAT
TTTAAACATGTGATGAGGGGTGATGTACATGATTAA60
120
180
240
300
360
420
480
540
600
660
720
780
816
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: NWMN_2361 [new locus tag: NWMN_RS13610 ]
- symbol: Opp1D
- description: peptide ABC transporter ATP-binding protein
- length: 271
- theoretical pI: 7.77588
- theoretical MW: 30468.3
- GRAVY: -0.122878
⊟Function[edit | edit source]
- TIGRFAM: Transport and binding proteins Cations and iron carrying compounds nickel import ATP-binding protein NikD (TIGR02770; HMM-score: 266.1)and 73 moreTransport and binding proteins Cations and iron carrying compounds nickel import ATP-binding protein NikE (TIGR02769; EC 3.6.3.24; HMM-score: 172.7)Transport and binding proteins Amino acids, peptides and amines glycine betaine/L-proline transport ATP binding subunit (TIGR01186; HMM-score: 147.7)Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04521; EC 3.6.3.-; HMM-score: 138)D-methionine ABC transporter, ATP-binding protein (TIGR02314; EC 3.6.3.-; HMM-score: 129.5)Transport and binding proteins Anions phosphate ABC transporter, ATP-binding protein (TIGR00972; EC 3.6.3.27; HMM-score: 128.3)Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04520; EC 3.6.3.-; HMM-score: 121.3)Transport and binding proteins Anions phosphonate ABC transporter, ATP-binding protein (TIGR02315; EC 3.6.3.28; HMM-score: 112.7)ectoine/hydroxyectoine ABC transporter, ATP-binding protein EhuA (TIGR03005; HMM-score: 112.4)Transport and binding proteins Amino acids, peptides and amines choline ABC transporter, ATP-binding protein (TIGR03415; HMM-score: 110.4)Protein fate Protein and peptide secretion and trafficking lipoprotein releasing system, ATP-binding protein (TIGR02211; EC 3.6.3.-; HMM-score: 109.6)Transport and binding proteins Anions molybdate ABC transporter, ATP-binding protein (TIGR02142; EC 3.6.3.29; HMM-score: 104.8)ABC exporter ATP-binding subunit, DevA family (TIGR02982; HMM-score: 104.1)Transport and binding proteins Anions sulfate ABC transporter, ATP-binding protein (TIGR00968; EC 3.6.3.25; HMM-score: 102.8)Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 102)Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 102)Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 100.7)Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 100.7)Transport and binding proteins Amino acids, peptides and amines putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein (TIGR03265; HMM-score: 100.6)Central intermediary metabolism Phosphorus compounds phosphonate C-P lyase system protein PhnK (TIGR02323; HMM-score: 100.1)Cellular processes Toxin production and resistance putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 99.6)Transport and binding proteins Unknown substrate putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 99.6)Energy metabolism Methanogenesis methyl coenzyme M reductase system, component A2 (TIGR03269; HMM-score: 94.7)Cellular processes Cell division cell division ATP-binding protein FtsE (TIGR02673; HMM-score: 94)Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01842; HMM-score: 93.7)Transport and binding proteins Anions nitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 93.1)Transport and binding proteins Other nitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 93.1)Transport and binding proteins Other daunorubicin resistance ABC transporter, ATP-binding protein (TIGR01188; HMM-score: 92.8)Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 90.5)Transport and binding proteins Other lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 90.5)2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT (TIGR03258; HMM-score: 90.4)Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtE (TIGR03410; HMM-score: 88.4)Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 88.3)Transport and binding proteins Other LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 88.3)proposed F420-0 ABC transporter, ATP-binding protein (TIGR03873; HMM-score: 85.9)Cellular processes Pathogenesis type I secretion system ATPase (TIGR03375; HMM-score: 85)Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR03375; HMM-score: 85)Protein fate Protein and peptide secretion and trafficking ABC-type bacteriocin transporter (TIGR01193; HMM-score: 83.4)Protein fate Protein modification and repair ABC-type bacteriocin transporter (TIGR01193; HMM-score: 83.4)Transport and binding proteins Other ABC-type bacteriocin transporter (TIGR01193; HMM-score: 83.4)Transport and binding proteins Amino acids, peptides and amines polyamine ABC transporter, ATP-binding protein (TIGR01187; EC 3.6.3.31; HMM-score: 82)lantibiotic protection ABC transporter, ATP-binding subunit (TIGR03740; HMM-score: 81.1)Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01846; HMM-score: 79.1)ABC transporter, permease/ATP-binding protein (TIGR02204; HMM-score: 78.5)Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtD (TIGR03411; HMM-score: 76.5)thiol reductant ABC exporter, CydD subunit (TIGR02857; HMM-score: 76.1)Cellular processes Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 75.9)Transport and binding proteins Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 75.9)Transport and binding proteins Carbohydrates, organic alcohols, and acids D-xylose ABC transporter, ATP-binding protein (TIGR02633; EC 3.6.3.17; HMM-score: 75.7)Transport and binding proteins Other antigen peptide transporter 2 (TIGR00958; HMM-score: 74)Biosynthesis of cofactors, prosthetic groups, and carriers Other FeS assembly ATPase SufC (TIGR01978; HMM-score: 69.1)Transport and binding proteins Carbohydrates, organic alcohols, and acids ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system (TIGR03864; HMM-score: 69.1)phosphonate C-P lyase system protein PhnL (TIGR02324; HMM-score: 67.7)thiol reductant ABC exporter, CydC subunit (TIGR02868; HMM-score: 67)Transport and binding proteins Cations and iron carrying compounds cobalt ABC transporter, ATP-binding protein (TIGR01166; HMM-score: 66.9)Transport and binding proteins Other pigment precursor permease (TIGR00955; HMM-score: 66)Transport and binding proteins Unknown substrate anchored repeat-type ABC transporter, ATP-binding subunit (TIGR03771; HMM-score: 64.8)Transport and binding proteins Other thiamine ABC transporter, ATP-binding protein (TIGR01277; EC 3.6.3.-; HMM-score: 59.6)gliding motility-associated ABC transporter ATP-binding subunit GldA (TIGR03522; HMM-score: 58.5)Transport and binding proteins Carbohydrates, organic alcohols, and acids glucan exporter ATP-binding protein (TIGR01192; EC 3.6.3.42; HMM-score: 57.1)ATP-binding cassette protein, ChvD family (TIGR03719; HMM-score: 53)Transport and binding proteins Anions cystic fibrosis transmembrane conductor regulator (CFTR) (TIGR01271; EC 3.6.3.49; HMM-score: 45.6)Protein fate Protein and peptide secretion and trafficking heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 38.5)Transport and binding proteins Other heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 38.5)Transport and binding proteins Other multi drug resistance-associated protein (MRP) (TIGR00957; HMM-score: 36.9)Transport and binding proteins Other rim ABC transporter (TIGR01257; HMM-score: 34)Transport and binding proteins Other pleiotropic drug resistance family protein (TIGR00956; HMM-score: 31)Transport and binding proteins Carbohydrates, organic alcohols, and acids peroxysomal long chain fatty acyl transporter (TIGR00954; HMM-score: 26.7)DNA metabolism DNA replication, recombination, and repair excinuclease ABC subunit A (TIGR00630; EC 3.1.25.-; HMM-score: 22.5)Transport and binding proteins Amino acids, peptides and amines oligopeptide/dipeptide ABC transporter, ATP-binding protein, C-terminal domain (TIGR01727; HMM-score: 19.8)Transport and binding proteins Amino acids, peptides and amines cyclic peptide transporter (TIGR01194; HMM-score: 18.9)Transport and binding proteins Other cyclic peptide transporter (TIGR01194; HMM-score: 18.9)Hypothetical proteins Conserved TIGR00162 family protein (TIGR00162; HMM-score: 12.6)rad50 (TIGR00606; HMM-score: 11.1)
- TheSEED :
- Oligopeptide transporter putative ATPase domain
- PFAM: P-loop_NTPase (CL0023) ABC_tran; ABC transporter (PF00005; HMM-score: 98.7)and 6 moreSMC_N; RecF/RecN/SMC N terminal domain (PF02463; HMM-score: 22)no clan defined oligo_HPY; Oligopeptide/dipeptide transporter, C-terminal region (PF08352; HMM-score: 19.5)P-loop_NTPase (CL0023) AAA_22; AAA domain (PF13401; HMM-score: 18.3)ATP-synt_ab; ATP synthase alpha/beta family, nucleotide-binding domain (PF00006; HMM-score: 14.2)DUF87; Helicase HerA, central domain (PF01935; HMM-score: 13.3)no clan defined GMAP; Galanin message associated peptide (GMAP) (PF06540; HMM-score: 12.2)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0.17
- Cytoplasmic Membrane Score: 9.51
- Cellwall Score: 0.16
- Extracellular Score: 0.15
- Internal Helices: 0
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0.1949
- Cytoplasmic Membrane Score: 0.7845
- Cell wall & surface Score: 0.0005
- Extracellular Score: 0.0202
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.023632
- TAT(Tat/SPI): 0.000399
- LIPO(Sec/SPII): 0.001212
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MTLLTVKHLTITDTWTDQPLVSDVNFTLTKGETLGVIGESGSGKSITCKSIIGLNPERLGVTGEIIFDGTSMLSLSESQLKKYRGKDIAMVMQQGSRAFDPSTTVGKQMFETMKVHTSMSTQEIEKTLIEYMDYLSLKDPKRILKSYPYMLSGGMLQRLMIALALALKPKLIIADEPTTALDTITQYDVLEAFIDIKKHFDCAMIFISHDLTVINKIADRVVVMKNGQLIEQGTRESVLHHPEHVYTKYLLSTKKKINDHFKHVMRGDVHD
⊟Experimental data[edit | edit source]
- experimentally validated: data available for NCTC8325
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
⊟Relevant publications[edit | edit source]
Laetitia Remy, Marie Carrière, Aurélie Derré-Bobillot, Cécilia Martini, Maurizio Sanguinetti, Elise Borezée-Durant
The Staphylococcus aureus Opp1 ABC transporter imports nickel and cobalt in zinc-depleted conditions and contributes to virulence.
Mol Microbiol: 2013, 87(4);730-43
[PubMed:23279021] [WorldCat.org] [DOI] (I p)