Jump to navigation
Jump to search
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus USA300_FPR3757
- locus tag: SAUSA300_RS13435 [old locus tag: SAUSA300_2425 ]
- pan locus tag?: SAUPAN006074000
- symbol: SAUSA300_RS13435
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAUSA300_RS13435 [old locus tag: SAUSA300_2425 ]
- symbol: SAUSA300_RS13435
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 2610911..2611198
- length: 288
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Location: NC_007793 (2610911..2611198) NCBI
- BioCyc: see SAUSA300_2425
- MicrobesOnline: see SAUSA300_2425
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241GTGGGACTTGATTTTAGTGGTTTACCAGATTTAGCAGTATTGGAACAAATGAAGGAAAAA
GAACAGATTAGTGAGGTTATTGCGCCTGAACATGTTCGTATGCATCATGATCATCAAAAT
AAGCTGAAAAGTGATGAGAAAATATTACTTGACCAAATGGTAAGTCATTTCAAAAAATTT
GAAGATGATTTTAAAAATGCGGCACAAGGGGCTTGGGTGAAAAATGCCACAGACGAATTA
AAAGATATTAGTAATGATTTAGAAAAAATTCAAGATATTAAAGTATAA60
120
180
240
288
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAUSA300_RS13435 [old locus tag: SAUSA300_2425 ]
- symbol: SAUSA300_RS13435
- description: hypothetical protein
- length: 95
- theoretical pI: 4.93252
- theoretical MW: 10971.4
- GRAVY: -0.697895
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED: see SAUSA300_2425
- PFAM: YycI_YycH (CL0285) YycH; YycH protein (PF07435; HMM-score: 15.2)no clan defined Nuc_rec_co-act; Nuclear receptor coactivator (PF08815; HMM-score: 14.2)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.002111
- TAT(Tat/SPI): 0.000151
- LIPO(Sec/SPII): 0.000276
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI: 446444103 NCBI
- RefSeq: WP_000521958 NCBI
- UniProt: see SAUSA300_2425
⊟Protein sequence[edit | edit source]
- MGLDFSGLPDLAVLEQMKEKEQISEVIAPEHVRMHHDHQNKLKSDEKILLDQMVSHFKKFEDDFKNAAQGAWVKNATDELKDISNDLEKIQDIKV
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
⊟Relevant publications[edit | edit source]