From AureoWiki
Jump to navigation Jump to search

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus N315
  • locus tag: SA_RS02255 [old locus tag: SA0393 ]
  • pan locus tag?: SAUPAN002129000
  • symbol: SA_RS02255
  • pan gene symbol?: ssl11
  • synonym:
  • product: hypothetical protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SA_RS02255 [old locus tag: SA0393 ]
  • symbol: SA_RS02255
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 454143..454826
  • length: 684
  • essential: unknown

Accession numbers[edit | edit source]

  • Location: NC_002745 (454143..454826) NCBI
  • BioCyc: G1G21-434 BioCyc
  • MicrobesOnline:

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    ATGAAATTAAAAAATATTGCTAAAGCAAGTTTAGCACTAGGGATTTTAACAACAGGTATG
    ATTACAACTACTGCTCAGCCAGTAAAAGCAAGTACATTAGAGGTTAGATCACAAGCTACT
    CAAGACTTGAGTGAATATTATAAAGGGAGAGGATTTGAATTAACAAATGTAACAGGATAT
    AAATACGGAAATAAAGTTACATTTATAGATAATTCTCAACAAATTGATGTTACATTGACA
    GGAAATGAAAAATTAACTGTTAAAGATGATGACGAAGTTTCTAATGTTGACGTGTTTGTA
    GTAAGAGAAGGTAGTGACAAATCAGCTATCACAACATCGATTGGTGGAATTACAAAGACA
    AATGGGACTCAACATAAAGATACTGTTCAAAACGTTAATTTGTCAGTTTCTAAGAGTACA
    GGTCAACACACTACTTCTGTGACTTCAGAATACTATAGCATCTATAAAGAAGAAATCTCA
    TTAAAAGAACTTGATTTTAAATTAAGAAAGCATTTAATTGATAAACATGATCTTTATAAG
    ACAGAACCTAAAGACAGTAAAATTAGAATTACTATGAAAAACGGTGGCTATTATACATTT
    GAATTAAATAAAAAATTACAGCCTCATCGCATGGGTGATACGATTGATAGTAGAAATATA
    GAGAAAATTGAAGTGAATTTATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    684

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SA_RS02255 [old locus tag: SA0393 ]
  • symbol: SA_RS02255
  • description: hypothetical protein
  • length: 227
  • theoretical pI: 9.3074
  • theoretical MW: 25439.5
  • GRAVY: -0.611454

Function[edit | edit source]

  • TIGRFAM:
    phospholamban (TIGR01294; HMM-score: 11.2)
  • TheSEED:
  • PFAM:
    OB_enterotoxin (CL0658) SSL_OB; Staphylococcal superantigen-like OB-fold domain (PF09199; HMM-score: 69.5)
    and 3 more
    Ant-toxin_C (CL0386) Stap_Strp_tox_C; Staphylococcal/Streptococcal toxin, beta-grasp domain (PF02876; HMM-score: 27.3)
    no clan defined DUF5322; Family of unknown function (DUF5322) (PF17255; HMM-score: 13.1)
    GT-C (CL0111) PTPS_related; 6-pyruvoyl-tetrahydropterin synthase related domain; membrane protein (PF10131; HMM-score: 9.3)

Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit | edit source]

  • PSORTb: Extracellular
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0
    • Extracellular Score: 10
    • Internal Helices: 0
  • LocateP:
  • SignalP: Signal peptide SP(Sec/SPI) length 30 aa
    • SP(Sec/SPI): 0.988485
    • TAT(Tat/SPI): 0.007632
    • LIPO(Sec/SPII): 0.00239
    • Cleavage Site: CS pos: 30-31. VKA-ST. Pr: 0.8556
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

  • GI: 446691814 NCBI
  • RefSeq: WP_000769160 NCBI
  • UniProt:

Protein sequence[edit | edit source]

  • MKLKNIAKASLALGILTTGMITTTAQPVKASTLEVRSQATQDLSEYYKGRGFELTNVTGYKYGNKVTFIDNSQQIDVTLTGNEKLTVKDDDEVSNVDVFVVREGSDKSAITTSIGGITKTNGTQHKDTVQNVNLSVSKSTGQHTTSVTSEYYSIYKEEISLKELDFKLRKHLIDKHDLYKTEPKDSKIRITMKNGGYYTFELNKKLQPHRMGDTIDSRNIEKIEVNL

Experimental data[edit | edit source]

  • experimentally validated: no data available

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]