Jump to navigation
Jump to search
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus N315
- locus tag: SA_RS04600 [old locus tag: SA0807 ]
- pan locus tag?: SAUPAN003047000
- symbol: SA_RS04600
- pan gene symbol?: mnhG
- synonym:
- product: Na+/H+ antiporter subunit G
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SA_RS04600 [old locus tag: SA0807 ]
- symbol: SA_RS04600
- product: Na+/H+ antiporter subunit G
- replicon: chromosome
- strand: -
- coordinates: 912366..912722
- length: 357
- essential: no DEG other strains
⊟Accession numbers[edit | edit source]
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGATCAAAATCATACTGATTAGTCTTGCACTTATCTTTGTTATCATCGGTGCTTTAATT
AGCGCCCTAGCAGCTATAGGATTATTGAGACTTGAAGATGTATATTCACGTGCACATGCT
GCCGGAAAAGCATCAACATTAGGTGCAATGTCATTACTATTTGGTACTTTTTTATATTTT
ATTGCTACTCAAGGTTTTGTAAATATGCAATTAATCGTTGCGATTATCTTTGTATTAATT
ACAGGTCCTCTTTCAAGTCATATGATTATGAAAGCAGCATATAATATTAAAACGCCTTAT
ACTAAAAAGACTAAAGTCGATGAAATTTCGGAAGACTTAAAAGACACAAAATTGTAG60
120
180
240
300
357
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SA_RS04600 [old locus tag: SA0807 ]
- symbol: SA_RS04600
- description: Na+/H+ antiporter subunit G
- length: 118
- theoretical pI: 10.0063
- theoretical MW: 12818.4
- GRAVY: 0.894915
⊟Function[edit | edit source]
- TIGRFAM: Transport and binding proteins Cations and iron carrying compounds monovalent cation/proton antiporter, MnhG/PhaG subunit (TIGR01300; HMM-score: 87.9)
- TheSEED: see SA0807
- PFAM: no clan defined PhaG_MnhG_YufB; Na+/H+ antiporter subunit (PF03334; HMM-score: 88.7)and 4 morePhage_holin_6_1; Bacteriophage holin of superfamily 6 (Holin_LLH) (PF09682; HMM-score: 9.3)YtpI; YtpI-like protein (PF14007; HMM-score: 8.6)Sigma_reg_N; Sigma factor regulator N-terminal (PF13800; HMM-score: 7.2)Tetraspannin (CL0347) Tetraspannin; Tetraspanin family (PF00335; HMM-score: 6.3)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 10
- Cellwall Score: 0
- Extracellular Score: 0
- Internal Helices: 3
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.04049
- TAT(Tat/SPI): 0.001137
- LIPO(Sec/SPII): 0.042421
- predicted transmembrane helices (TMHMM): 3
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MIKIILISLALIFVIIGALISALAAIGLLRLEDVYSRAHAAGKASTLGAMSLLFGTFLYFIATQGFVNMQLIVAIIFVLITGPLSSHMIMKAAYNIKTPYTKKTKVDEISEDLKDTKL
⊟Experimental data[edit | edit source]
- experimentally validated: data available for COL, NCTC8325
- protein localization: data available for COL
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
⊟Relevant publications[edit | edit source]