From AureoWiki
Jump to navigation Jump to search

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus N315
  • locus tag: SA_RS04730 [old locus tag: SA0833 ]
  • pan locus tag?: SAUPAN003109000
  • symbol: SA_RS04730
  • pan gene symbol?: sufT
  • synonym:
  • product: DNA methyltransferase

Additional information (user-provided)[edit | edit source]

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SA_RS04730 [old locus tag: SA0833 ]
  • symbol: SA_RS04730
  • product: DNA methyltransferase
  • replicon: chromosome
  • strand: +
  • coordinates: 943771..944079
  • length: 309
  • essential: no DEG other strains

Accession numbers[edit | edit source]

  • Location: NC_002745 (943771..944079) NCBI
  • BioCyc: SA_RS04730 BioCyc
  • MicrobesOnline: see SA0833

Phenotype[edit | edit source]

Additional information (user-provided)[edit | edit source]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    ATGGAAGAGGCATTGAAAGATAGTATCTTAGGTGCATTAGAAATGGTAATTGACCCTGAA
    TTAGGAATTGATATCGTTAATTTAGGTTTAGTATACAAAGTGAATGTTGATGATGAAGGC
    GTATGTACAGTTGATATGACTTTAACATCAATGGGATGTCCAATGGGACCTCAAATTATT
    GATCAAGTTAAAACAGTATTAGCAGAGATTCCTGAAATTCAGGATACTGAAGTGAATATC
    GTATGGAGTCCACCTTGGACAAAAGATATGATGTCACGTTACGCTAAGATTGCACTTGGT
    GTGAGCTAA
    60
    120
    180
    240
    300
    309


Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SA_RS04730 [old locus tag: SA0833 ]
  • symbol: SA_RS04730
  • description: DNA methyltransferase
  • length: 102
  • theoretical pI: 3.77229
  • theoretical MW: 11153
  • GRAVY: 0.268627

Function[edit | edit source]

  • TIGRFAM:
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Other probable FeS assembly SUF system protein SufT (TIGR03406; HMM-score: 102.1)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Other FeS assembly SUF system protein (TIGR02945; HMM-score: 101.7)
    and 1 more
    Metabolism Energy metabolism Other phenylacetate-CoA oxygenase, PaaJ subunit (TIGR02159; HMM-score: 46.6)
  • TheSEED: see SA0833
  • PFAM:
    NifU (CL0232) FeS_assembly_P; Iron-sulfur cluster assembly protein (PF01883; HMM-score: 75.1)
    and 1 more
    PKinase (CL0016) Seadorna_VP7; Seadornavirus VP7 (PF07387; HMM-score: 11.8)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9843
    • Cytoplasmic Membrane Score: 0.0049
    • Cell wall & surface Score: 0
    • Extracellular Score: 0.0107
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.00666
    • TAT(Tat/SPI): 0.000209
    • LIPO(Sec/SPII): 0.000328
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Additional information (user-provided)[edit | edit source]

Protein sequence[edit | edit source]

  • MEEALKDSILGALEMVIDPELGIDIVNLGLVYKVNVDDEGVCTVDMTLTSMGCPMGPQIIDQVKTVLAEIPEIQDTEVNIVWSPPWTKDMMSRYAKIALGVS

Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Additional information (user-provided)[edit | edit source]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Additional information (user-provided)[edit | edit source]

Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]


Relevant publications[edit | edit source]