From AureoWiki
Jump to navigation Jump to search

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus N315
  • locus tag: SA_RS05160 [old locus tag: SA0910 ]
  • pan locus tag?: SAUPAN003267000
  • symbol: SA_RS05160
  • pan gene symbol?: qoxD
  • synonym:
  • product: quinol oxidase subunit 4

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SA_RS05160 [old locus tag: SA0910 ]
  • symbol: SA_RS05160
  • product: quinol oxidase subunit 4
  • replicon: chromosome
  • strand: -
  • coordinates: 1034821..1035111
  • length: 291
  • essential: unknown

Accession numbers[edit | edit source]

  • Location: NC_002745 (1034821..1035111) NCBI
  • BioCyc: G1G21-1038 BioCyc
  • MicrobesOnline:

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    ATGAGTACAATAATGAAACATACTGTAGGATTTATCGCATCTATCGTATTAACGCTTTTA
    GCAGTTTACGTAACACTATACACGTCATTAACATTCCACGCGAAGTTGACAATTATCTTT
    GGCTTTGCATTCGTCCAAGCAGGACTTCAATTATTAATGTTCATGCATTTAACTGAAGGT
    AAAGATGGACGTTTACAAACATTCAAAGTTATCTTTGCTCTTGTAATTACACTTTGTTTC
    GTTGTCGGAACATATTGGGTTATGCAAGGCGGTCACTCTTCACACTTATAA
    60
    120
    180
    240
    291

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SA_RS05160 [old locus tag: SA0910 ]
  • symbol: SA_RS05160
  • description: quinol oxidase subunit 4
  • length: 96
  • theoretical pI: 9.69391
  • theoretical MW: 10686.8
  • GRAVY: 1.01979

Function[edit | edit source]

  • reaction:
    EC 1.10.3.-?  ExPASy
    2 a quinol + O2 = 2 a quinone + 2 H2O?
  • TIGRFAM:
    Metabolism Energy metabolism Electron transport cytochrome aa3 quinol oxidase, subunit IV (TIGR02901; EC 1.10.3.-; HMM-score: 104.3)
    and 3 more
    Metabolism Energy metabolism Electron transport cytochrome o ubiquinol oxidase subunit IV (TIGR02847; EC 1.10.3.-; HMM-score: 55.5)
    Metabolism Energy metabolism Electron transport caa(3)-type oxidase, subunit IV (TIGR02229; HMM-score: 16.8)
    Metabolism Energy metabolism Electron transport cytochrome c oxidase, subunit IVB (TIGR02908; EC 1.9.3.1; HMM-score: 15.5)
  • TheSEED:
  • PFAM:
    no clan defined COX4_pro; Prokaryotic Cytochrome C oxidase subunit IV (PF03626; HMM-score: 45.5)
    and 2 more
    Yip1 (CL0112) DUF1700; Protein of unknown function (DUF1700) (PF08006; HMM-score: 9.9)
    no clan defined PHO4; Phosphate transporter family (PF01384; HMM-score: 7.9)

Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 10
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 3
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.005989
    • TAT(Tat/SPI): 0.00029
    • LIPO(Sec/SPII): 0.002534
  • predicted transmembrane helices (TMHMM): 3

Accession numbers[edit | edit source]

  • GI: 446026399 NCBI
  • RefSeq: WP_000104254 NCBI
  • UniProt:

Protein sequence[edit | edit source]

  • MSTIMKHTVGFIASIVLTLLAVYVTLYTSLTFHAKLTIIFGFAFVQAGLQLLMFMHLTEGKDGRLQTFKVIFALVITLCFVVGTYWVMQGGHSSHL

Experimental data[edit | edit source]

  • experimentally validated: no data available

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]