Jump to navigation
Jump to search
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus N315
- locus tag: SA_RS05670 [old locus tag: SA1000 ]
- pan locus tag?: SAUPAN003394000
- symbol: SA_RS05670
- pan gene symbol?: ecb
- synonym:
- product: fibrinogen-binding protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SA_RS05670 [old locus tag: SA1000 ]
- symbol: SA_RS05670
- product: fibrinogen-binding protein
- replicon: chromosome
- strand: +
- coordinates: 1133227..1133556
- length: 330
- essential: no DEG other strains
⊟Accession numbers[edit | edit source]
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGAAAAAGAATTTTATTGGGAAATCAATTTTAAGCATAGCTGCTATTAGTTTAACGGTA
TCAACGTTTGCCGGTGAATCTCATGCACAAACTAAAAACGTTGAAGCTGCTAAAAAATAT
GATCAGTATCAAACAAACTTTAAAAAACAAGTAAATAAAAAAGTTGTGGATGCACAAAAA
GCTGTAAACTTGTTCAAACGTACAAGAACTGTTGCAACACACCGTAAAGCACAAAGAGCT
GTTAATTTAATTCATTTCCAACACAGCTATGAAAAGAAAAAATTACAAAGACAAATCGAT
CTAGTTTTAAAATATAATACTTTAAAATAA60
120
180
240
300
330
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SA_RS05670 [old locus tag: SA1000 ]
- symbol: SA_RS05670
- description: fibrinogen-binding protein
- length: 109
- theoretical pI: 11.1179
- theoretical MW: 12562.5
- GRAVY: -0.623853
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED: see SA1000
- PFAM: no clan defined efb-c; Extracellular fibrinogen binding protein C terminal (PF12199; HMM-score: 128.4)and 2 moreSERRATE_Ars2_N; SERRATE/Ars2, N-terminal domain (PF12066; HMM-score: 17.5)IDEAL; IDEAL domain (PF08858; HMM-score: 13.4)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Extracellular
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 0.09
- Cellwall Score: 0.18
- Extracellular Score: 9.73
- Internal Helices: 0
- DeepLocPro: Extracellular
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 0.0006
- Cell wall & surface Score: 0.1039
- Extracellular Score: 0.8955
- LocateP:
- SignalP: Signal peptide SP(Sec/SPI) length 29 aa
- SP(Sec/SPI): 0.985507
- TAT(Tat/SPI): 0.002819
- LIPO(Sec/SPII): 0.010267
- Cleavage Site: CS pos: 29-30. SHA-QT. Pr: 0.8070
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MKKNFIGKSILSIAAISLTVSTFAGESHAQTKNVEAAKKYDQYQTNFKKQVNKKVVDAQKAVNLFKRTRTVATHRKAQRAVNLIHFQHSYEKKKLQRQIDLVLKYNTLK
⊟Experimental data[edit | edit source]
- experimentally validated: data available for COL, NCTC8325
- protein localization: data available for COL
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator: SaeR see SA1000
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]