Jump to navigation
Jump to search
NCBI: 26-AUG-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus N315
- locus tag: SA1000 [new locus tag: SA_RS05670 ]
- pan locus tag?: SAUPAN003394000
- symbol: SA1000
- pan gene symbol?: ecb
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SA1000 [new locus tag: SA_RS05670 ]
- symbol: SA1000
- product: hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 1133227..1133556
- length: 330
- essential: no DEG other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 1123828 NCBI
- RefSeq: NP_374271 NCBI
- BioCyc: see SA_RS05670
- MicrobesOnline: 103297 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGAAAAAGAATTTTATTGGGAAATCAATTTTAAGCATAGCTGCTATTAGTTTAACGGTA
TCAACGTTTGCCGGTGAATCTCATGCACAAACTAAAAACGTTGAAGCTGCTAAAAAATAT
GATCAGTATCAAACAAACTTTAAAAAACAAGTAAATAAAAAAGTTGTGGATGCACAAAAA
GCTGTAAACTTGTTCAAACGTACAAGAACTGTTGCAACACACCGTAAAGCACAAAGAGCT
GTTAATTTAATTCATTTCCAACACAGCTATGAAAAGAAAAAATTACAAAGACAAATCGAT
CTAGTTTTAAAATATAATACTTTAAAATAA60
120
180
240
300
330
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SA1000 [new locus tag: SA_RS05670 ]
- symbol: SA1000
- description: hypothetical protein
- length: 109
- theoretical pI: 11.1179
- theoretical MW: 12562.5
- GRAVY: -0.623853
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED :
- Hypothetical protein, similarity with fibrinogen-binding protein Efb
- PFAM: no clan defined efb-c; Extracellular fibrinogen binding protein C terminal (PF12199; HMM-score: 128.4)and 2 moreDUF3546; Domain of unknown function (DUF3546) (PF12066; HMM-score: 18.4)IDEAL; IDEAL domain (PF08858; HMM-score: 13.2)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Extracellular
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 0.09
- Cellwall Score: 0.18
- Extracellular Score: 9.73
- Internal Helices: 0
- LocateP: Secretory(released) (with CS)
- Prediction by SwissProt Classification: Extracellular
- Pathway Prediction: Sec-(SPI)
- Intracellular possibility: -0.17
- Signal peptide possibility: 1
- N-terminally Anchored Score: -2
- Predicted Cleavage Site: ESHAQTKN
- SignalP: Signal peptide SP(Sec/SPI) length 29 aa
- SP(Sec/SPI): 0.985507
- TAT(Tat/SPI): 0.002819
- LIPO(Sec/SPII): 0.010267
- Cleavage Site: CS pos: 29-30. SHA-QT. Pr: 0.8070
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MKKNFIGKSILSIAAISLTVSTFAGESHAQTKNVEAAKKYDQYQTNFKKQVNKKVVDAQKAVNLFKRTRTVATHRKAQRAVNLIHFQHSYEKKKLQRQIDLVLKYNTLK
⊟Experimental data[edit | edit source]
- experimentally validated: data available for COL, NCTC8325
- protein localization: data available for COL
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: no polycistronic organisation predicted
⊟Regulation[edit | edit source]
- regulator: SaeR (activation) regulon
SaeR (TF) important in Virulence; RegPrecise
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
⊟Relevant publications[edit | edit source]
Ilse Jongerius, Jörg Köhl, Manoj K Pandey, Maartje Ruyken, Kok P M van Kessel, Jos A G van Strijp, Suzan H M Rooijakkers
Staphylococcal complement evasion by various convertase-blocking molecules.
J Exp Med: 2007, 204(10);2461-71
[PubMed:17893203] [WorldCat.org] [DOI] (P p)