From AureoWiki
Jump to navigation Jump to search

NCBI: 26-AUG-2013

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus N315
  • locus tag: SA1000 [new locus tag: SA_RS05670 ]
  • pan locus tag?: SAUPAN003394000
  • symbol: SA1000
  • pan gene symbol?: ecb
  • synonym:
  • product: hypothetical protein

⊟Additional information (user-provided)[edit | edit source]

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SA1000 [new locus tag: SA_RS05670 ]
  • symbol: SA1000
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 1133227..1133556
  • length: 330
  • essential: no DEG other strains

⊟Accession numbers[edit | edit source]

⊟Phenotype[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    ATGAAAAAGAATTTTATTGGGAAATCAATTTTAAGCATAGCTGCTATTAGTTTAACGGTA
    TCAACGTTTGCCGGTGAATCTCATGCACAAACTAAAAACGTTGAAGCTGCTAAAAAATAT
    GATCAGTATCAAACAAACTTTAAAAAACAAGTAAATAAAAAAGTTGTGGATGCACAAAAA
    GCTGTAAACTTGTTCAAACGTACAAGAACTGTTGCAACACACCGTAAAGCACAAAGAGCT
    GTTAATTTAATTCATTTCCAACACAGCTATGAAAAGAAAAAATTACAAAGACAAATCGAT
    CTAGTTTTAAAATATAATACTTTAAAATAA
    60
    120
    180
    240
    300
    330


⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: SA1000 [new locus tag: SA_RS05670 ]
  • symbol: SA1000
  • description: hypothetical protein
  • length: 109
  • theoretical pI: 11.1179
  • theoretical MW: 12562.5
  • GRAVY: -0.623853

⊟Function[edit | edit source]

  • TIGRFAM:
  • TheSEED  :
    • Hypothetical protein, similarity with fibrinogen-binding protein Efb
    Virulence, Disease and Defense Adhesion Adhesins in Staphylococcus  Hypothetical protein, similarity with fibrinogen-binding protein Efb
  • PFAM:
    no clan defined efb-c; Extracellular fibrinogen binding protein C terminal (PF12199; HMM-score: 128.4)
    and 2 more
    SERRATE_Ars2_N; SERRATE/Ars2, N-terminal domain (PF12066; HMM-score: 17.5)
    IDEAL; IDEAL domain (PF08858; HMM-score: 13.4)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: Extracellular
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 0.09
    • Cellwall Score: 0.18
    • Extracellular Score: 9.73
    • Internal Helices: 0
  • DeepLocPro: Extracellular
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 0.0006
    • Cell wall & surface Score: 0.1039
    • Extracellular Score: 0.8955
  • LocateP: Secretory(released) (with CS)
    • Prediction by SwissProt Classification: Extracellular
    • Pathway Prediction: Sec-(SPI)
    • Intracellular possibility: -0.17
    • Signal peptide possibility: 1
    • N-terminally Anchored Score: -2
    • Predicted Cleavage Site: ESHAQTKN
  • SignalP: Signal peptide SP(Sec/SPI) length 29 aa
    • SP(Sec/SPI): 0.985507
    • TAT(Tat/SPI): 0.002819
    • LIPO(Sec/SPII): 0.010267
    • Cleavage Site: CS pos: 29-30. SHA-QT. Pr: 0.8070
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MKKNFIGKSILSIAAISLTVSTFAGESHAQTKNVEAAKKYDQYQTNFKKQVNKKVVDAQKAVNLFKRTRTVATHRKAQRAVNLIHFQHSYEKKKLQRQIDLVLKYNTLK

⊟Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell:
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator: SaeR (activation) regulon
    SaeR(TF)important in Virulence; RegPrecise 

⊟Additional information (user-provided)[edit | edit source]

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

⊟Literature[edit | edit source]

⊟References[edit | edit source]


⊟Relevant publications[edit | edit source]

Ilse Jongerius, Jörg Köhl, Manoj K Pandey, Maartje Ruyken, Kok P M van Kessel, Jos A G van Strijp, Suzan H M Rooijakkers
Staphylococcal complement evasion by various convertase-blocking molecules.
J Exp Med: 2007, 204(10);2461-71
[PubMed:17893203] [WorldCat.org] [DOI] (P p)