From AureoWiki
Jump to navigation Jump to search

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus N315
  • locus tag: SA_RS08925 [old locus tag: SA1584 ]
  • pan locus tag?: SAUPAN004452000
  • symbol: SA_RS08925
  • pan gene symbol?:
  • synonym:
  • product: alpha/beta hydrolase

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SA_RS08925 [old locus tag: SA1584 ]
  • symbol: SA_RS08925
  • product: alpha/beta hydrolase
  • replicon: chromosome
  • strand: -
  • coordinates: 1822783..1823610
  • length: 828
  • essential: unknown

Accession numbers[edit | edit source]

  • Location: NC_002745 (1822783..1823610) NCBI
  • BioCyc: G1G21-1802 BioCyc
  • MicrobesOnline:

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    ATGTGGAAGTGGGAAGCTGAAAATGATGCGAAAGGCGTCGTTGTTATTGCTCATAATATA
    TTAGAACATACGGGAAGATATGCATATGTTATTACGATGTTAAGAAGAAATGGCTATCAT
    GTGATTATGGGAGATTTGCCTGGTCAAGGTCAAACTTCAAGAGCTAATAAAGGACAAATT
    GAAAACTTTCAAACGTATCACGAAAGTTTGCTAGATTGGTTAAAGATAGCTAATGAATAT
    AAAATTCCTACTTATGTATTAGGGGTAGGACTTGGCGGTTTGATTTTATTAAATTTACTT
    GAAAAAGTAGAATTGCCAATCGAGGGGATGATGTTAATTTCTCCTATGCTAGAACTTCAA
    AAGAATGGAAAAAATCGTAAAGATAAACTTGTTTCAAATATAGGTAAAATTTCAAAAGAC
    ACACGTTTTAATGTTGGTGTAGAACCAAAAGATTTAACACGTAATTTAGAAATTGTTGAA
    GAAACAGTTAACGATGGTTTAATGTTAAAAAAAGCAACGTATCATTGGTATAATACAATT
    AATGAGACGATGAAAGATACGATGGCTCATATTCATGACATTCAACCAATGCCAACGCTA
    TTAATGTATGGAACGAAGGATTTAATTGTTGATACTAGGGCAATTGATGAGTTTAAAGAA
    AAATATCAAACACCTGAATTATATTTTAAAGCTTGGCAAGGTTTTTACCACGAGGTTCAC
    AATGAGCCAGAACGTGATGAAGTAATGCGTTATATTCTGACTTTCTTAAATAACAGCGTC
    AATACAATGGGCTTTATTGTTGAAGATGACGAAATTGTAGAAATTTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    828

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SA_RS08925 [old locus tag: SA1584 ]
  • symbol: SA_RS08925
  • description: alpha/beta hydrolase
  • length: 275
  • theoretical pI: 5.40101
  • theoretical MW: 31865.4
  • GRAVY: -0.362182

Function[edit | edit source]

  • TIGRFAM:
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Menaquinone and ubiquinone 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase (TIGR03695; EC 4.2.99.20; HMM-score: 32.7)
    and 2 more
    Metabolism Energy metabolism Photosynthesis putative magnesium chelatase accessory protein (TIGR03056; HMM-score: 20.5)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Biotin pimelyl-[acyl-carrier protein] methyl ester esterase (TIGR01738; EC 3.1.1.85; HMM-score: 20)
  • TheSEED:
  • PFAM:
    AB_hydrolase (CL0028) Hydrolase_4; Serine aminopeptidase, S33 (PF12146; HMM-score: 144.7)
    and 5 more
    Abhydrolase_1; alpha/beta hydrolase fold (PF00561; HMM-score: 48)
    DUF1057; Alpha/beta hydrolase of unknown function (DUF1057) (PF06342; HMM-score: 21.3)
    Abhydrolase_6; Alpha/beta hydrolase family (PF12697; HMM-score: 20.1)
    DLH; Dienelactone hydrolase family (PF01738; HMM-score: 17.8)
    LIDHydrolase; Lipid-droplet associated hydrolase (PF10230; HMM-score: 12.6)

Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.004227
    • TAT(Tat/SPI): 0.000733
    • LIPO(Sec/SPII): 0.000546
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

  • GI: 446188241 NCBI
  • RefSeq: WP_000266096 NCBI
  • UniProt:

Protein sequence[edit | edit source]

  • MWKWEAENDAKGVVVIAHNILEHTGRYAYVITMLRRNGYHVIMGDLPGQGQTSRANKGQIENFQTYHESLLDWLKIANEYKIPTYVLGVGLGGLILLNLLEKVELPIEGMMLISPMLELQKNGKNRKDKLVSNIGKISKDTRFNVGVEPKDLTRNLEIVEETVNDGLMLKKATYHWYNTINETMKDTMAHIHDIQPMPTLLMYGTKDLIVDTRAIDEFKEKYQTPELYFKAWQGFYHEVHNEPERDEVMRYILTFLNNSVNTMGFIVEDDEIVEI

Experimental data[edit | edit source]

  • experimentally validated: no data available

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]