Jump to navigation
Jump to search
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus N315
- locus tag: SA_RS08965 [old locus tag: SA1591 ]
- pan locus tag?: SAUPAN004463000
- symbol: SA_RS08965
- pan gene symbol?: arsR
- synonym:
- product: transcriptional regulator
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
⊟Accession numbers[edit | edit source]
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGACGTATAAAGAACTAGCAACATTTTTAAAAGTTTTATCAGATTCAAGCAGATTAGAA
ATACTAGATTTACTTTCTTGTGGAGAGTTATGCGCTTGTGATTTGTTAGCACATTTTCAA
TTCTCTCAACCCACACTTAGCTATCATTTGAAAGCATTAGTAAAAACCAACTTAGTTACG
ACACGAAAAATCGGAAATAAACATTTATACCAGCTTAATCATAATATTTTTGAGTCCGTA
ATTAATAACTTGTCTAAGGTTCATACCTCTAACCAACGATGTTTTTGTCATAACCTTAAG
ACTGGTGAATGCTAA60
120
180
240
300
315
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SA_RS08965 [old locus tag: SA1591 ]
- symbol: SA_RS08965
- description: transcriptional regulator
- length: 104
- theoretical pI: 8.38639
- theoretical MW: 11856.7
- GRAVY: -0.0759615
⊟Function[edit | edit source]
- TIGRFAM: Regulatory functions DNA interactions CRISPR locus-related DNA-binding protein (TIGR01884; HMM-score: 13.6)
- TheSEED: see SA1591
- PFAM: HTH (CL0123) HTH_5; Bacterial regulatory protein, arsR family (PF01022; HMM-score: 58.9)and 8 moreHTH_20; Helix-turn-helix domain (PF12840; HMM-score: 31.8)Dimerisation; Plant O-methyltransferase dimerisation domain (PF08100; HMM-score: 20.8)MarR_2; MarR family (PF12802; HMM-score: 16.2)MarR; MarR family (PF01047; HMM-score: 15.2)DUF7347; Domain of unknown function (DUF7347) (PF24038; HMM-score: 13.5)HTH_24; Winged helix-turn-helix DNA-binding (PF13412; HMM-score: 12.9)DUF7342; Family of unknown function (DUF7342) (PF24033; HMM-score: 12.6)no clan defined GAAD; GTPase-associated adaptor domain (PF19976; HMM-score: 12)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
- genes regulated by ArsR*, TF important in Arsenic resistance: see SA1591
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9949
- Cytoplasmic Membrane Score: 0.0002
- Cell wall & surface Score: 0.0006
- Extracellular Score: 0.0043
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.024512
- TAT(Tat/SPI): 0.003316
- LIPO(Sec/SPII): 0.064463
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MTYKELATFLKVLSDSSRLEILDLLSCGELCACDLLAHFQFSQPTLSYHLKALVKTNLVTTRKIGNKHLYQLNHNIFESVINNLSKVHTSNQRCFCHNLKTGEC
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator: ArsR* see SA1591
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.