From AureoWiki
Jump to navigation Jump to search

NCBI: 02-MAR-2017

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus N315
  • locus tag: SA_RS10990 [old locus tag: SA1910 ]
  • pan locus tag?: SAUPAN005399000
  • symbol: SA_RS10990
  • pan gene symbol?: atpE
  • synonym:
  • product: ATP synthase subunit C

⊟Additional information (user-provided)[edit | edit source]

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SA_RS10990 [old locus tag: SA1910 ]
  • symbol: SA_RS10990
  • product: ATP synthase subunit C
  • replicon: chromosome
  • strand: -
  • coordinates: 2160718..2160930
  • length: 213
  • essential: no DEG other strains

⊟Accession numbers[edit | edit source]

  • Location: NC_002745 (2160718..2160930) NCBI
  • BioCyc: SA_RS10990 BioCyc
  • MicrobesOnline: see SA1910

⊟Phenotype[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    ATGAATTTAATCGCAGCAGCAATCGCAATTGGTTTATCAGCATTAGGAGCAGGTATCGGT
    AACGGTTTAATCGTTTCAAGAACAGTTGAAGGTGTAGCACGTCAACCAGAAGCACGTGGT
    CAATTAATGGGTATCATGTTCATTGGTGTAGGTTTAGTTGAGGCATTACCTATCATCGGT
    GTAGTAATTGCATTCATGACATTTGCTGGATAA
    60
    120
    180
    213


⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: SA_RS10990 [old locus tag: SA1910 ]
  • symbol: SA_RS10990
  • description: ATP synthase subunit C
  • length: 70
  • theoretical pI: 6.61182
  • theoretical MW: 6979.38
  • GRAVY: 1.25429

⊟Function[edit | edit source]

  • reaction:
    EC 3.6.3.14?  ExPASy
    H+-transporting two-sector ATPase ATP + H2O + H+(In) = ADP + phosphate + H+(Out)
  • TIGRFAM:
    Metabolism Energy metabolism ATP-proton motive force interconversion ATP synthase F0, C subunit (TIGR01260; EC 3.6.3.14; HMM-score: 73.7)
    and 1 more
    alternate F1F0 ATPase, F0 subunit C (TIGR03322; EC 3.6.3.-; HMM-score: 31.8)
  • TheSEED: see SA1910
  • PFAM:
    no clan defined ATP-synt_C; ATP synthase subunit C (PF00137; HMM-score: 64.4)
    and 1 more
    DUF5362; Family of unknown function (DUF5362) (PF17319; HMM-score: 13.8)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.32
    • Cytoplasmic Membrane Score: 9.55
    • Cellwall Score: 0.12
    • Extracellular Score: 0.01
    • Internal Helices: 2
  • DeepLocPro: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.0002
    • Cytoplasmic Membrane Score: 0.9584
    • Cell wall & surface Score: 0
    • Extracellular Score: 0.0414
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.064922
    • TAT(Tat/SPI): 0.003265
    • LIPO(Sec/SPII): 0.180633
  • predicted transmembrane helices (TMHMM): 2

⊟Accession numbers[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MNLIAAAIAIGLSALGAGIGNGLIVSRTVEGVARQPEARGQLMGIMFIGVGLVEALPIIGVVIAFMTFAG

⊟Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell:
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator:

⊟Additional information (user-provided)[edit | edit source]

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

⊟Literature[edit | edit source]

⊟References[edit | edit source]


⊟Relevant publications[edit | edit source]