From AureoWiki
Jump to: navigation, search

NCBI: 02-MAR-2017

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA_RS12570 [old locus tag: SA2192 ]
  • pan locus tag?: SAUPAN005936000
  • symbol: SA_RS12570
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA_RS12570 [old locus tag: SA2192 ]
  • symbol: SA_RS12570
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2463240..2463422
  • length: 183
  • essential: unknown

Accession numbers[edit source | edit]

  • Location: NC_002745 (2463240..2463422) NCBI
  • BioCyc: G1G21-2549 BioCyc
  • MicrobesOnline:

Phenotype[edit source | edit]

Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    ATGGTAGAACGTTATATCAAAGTTTTAATATTATATATTTTCACAACACTACTATCTTCT
    ATTTCAGTAACGTCAAAATGTGTACCTAATAAAGTTATAAGGTTTATTTTACGTACTGCA
    ATTGGTTACAGTATATTTGCATATGGTTTACATTACTTTTCAAATTTAAAAAAGAATAAG
    TAA
    60
    120
    180
    183

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA_RS12570 [old locus tag: SA2192 ]
  • symbol: SA_RS12570
  • description: hypothetical protein
  • length: 60
  • theoretical pI: 10.5747
  • theoretical MW: 6976.38
  • GRAVY: 0.536667

Function[edit source | edit]

  • TIGRFAM:
  • TheSEED:
  • PFAM:
    no clan definedMyco_arth_vir_N; Mycoplasma virulence signal region (Myco_arth_vir_N) (PF09610; HMM-score: 9.4)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.32
    • Cytoplasmic Membrane Score: 9.55
    • Cellwall Score: 0.12
    • Extracellular Score: 0.01
    • Internal Helices: 2
  • LocateP:
  • SignalP: Signal peptide LIPO(Sec/SPII) length 26 aa
    • SP(Sec/SPI): 0.315288
    • TAT(Tat/SPI): 0.00219
    • LIPO(Sec/SPII): 0.479173
    • Cleavage Site: CS pos: 26-27. TSK-CV. Pr: 0.3618
  • predicted transmembrane helices (TMHMM): 2

Accession numbers[edit source | edit]

  • GI: 446152437 NCBI
  • RefSeq: WP_000230292 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MVERYIKVLILYIFTTLLSSISVTSKCVPNKVIRFILRTAIGYSIFAYGLHYFSNLKKNK

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]