From AureoWiki
Jump to navigation Jump to search

NCBI: 03-AUG-2016

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus NCTC8325
  • locus tag: SAOUHSC_01315
  • pan locus tag?: SAUPAN003692000
  • symbol: SAOUHSC_01315
  • pan gene symbol?: —
  • synonym:
  • product: hypothetical protein

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SAOUHSC_01315
  • symbol: SAOUHSC_01315
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 1259029..1259217
  • length: 189
  • essential: no DEG other strains

⊟Accession numbers[edit | edit source]

⊟Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    ATGAACATTTCAAATGAAAATACAGTCACATTAATTGCAGTAATTATCGCAATTATCATT
    GGTATTTTCCTACAAATATTTTTCAAATTACCATTAATAGTGACGGCAGTACTATCTATT
    TTATTGGGTATCTTTGTAGGCTTTATCGTTTACTTGATTGTTTCGTTTTATAATAAGCGA
    AAAAATTAG
    60
    120
    180
    189

⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: SAOUHSC_01315
  • symbol: SAOUHSC_01315
  • description: hypothetical protein
  • length: 62
  • theoretical pI: 10.3273
  • theoretical MW: 6956.53
  • GRAVY: 1.55323

⊟Function[edit | edit source]

  • TIGRFAM:
    Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids MFS transporter, sugar porter (SP) family (TIGR00879; HMM-score: 12.5)
    Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids bile acid transporter (TIGR00841; HMM-score: 11.5)
    and 4 more
    cxxc_20_cxxc protein (TIGR04104; HMM-score: 8.3)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking type VII secretion protein EssA (TIGR03927; HMM-score: 7.5)
    chain length determinant protein EpsF (TIGR03017; HMM-score: 6.8)
    cobalt transporter subunit CbtB (proposed) (TIGR02459; HMM-score: 6.2)
  • TheSEED  :
    • FIG01108130: hypothetical protein
  • PFAM:
    MviN_MATE (CL0222) Polysacc_synt_C; Polysaccharide biosynthesis C-terminal domain (PF14667; HMM-score: 17.6)
    no clan defined DUF4396; Domain of unknown function (DUF4396) (PF14342; HMM-score: 17.3)
    Apoptosis-Inhib (CL0453) Bax1-I; Inhibitor of apoptosis-promoting Bax1 (PF01027; HMM-score: 16.1)
    no clan defined DUF2613; Protein of unknown function (DUF2613) (PF11021; HMM-score: 14.7)
    and 19 more
    RseC_MucC; Positive regulator of sigma(E), RseC/MucC (PF04246; HMM-score: 12.2)
    DUF4191; Domain of unknown function (DUF4191) (PF13829; HMM-score: 11.9)
    DUF2583; Protein of unknown function (DUF2583) (PF10762; HMM-score: 11.6)
    Peptidase_AD (CL0130) Peptidase_A24; Type IV leader peptidase family (PF01478; HMM-score: 11.5)
    O-anti_assembly (CL0499) Wzy_C; O-Antigen ligase (PF04932; HMM-score: 11.5)
    no clan defined Myc_target_1; Myc target protein 1 (PF15179; HMM-score: 10.8)
    Yip1 (CL0112) DUF1129; Protein of unknown function (DUF1129) (PF06570; HMM-score: 10.3)
    no clan defined DUF973; Protein of unknown function (DUF973) (PF06157; HMM-score: 10.1)
    DUF4407; Domain of unknown function (DUF4407) (PF14362; HMM-score: 9.9)
    ABC-2 (CL0181) ABC2_membrane_3; ABC-2 family transporter protein (PF12698; HMM-score: 8.6)
    no clan defined DUF2070; Predicted membrane protein (DUF2070) (PF09843; HMM-score: 8.4)
    Ninjurin; Ninjurin (PF04923; HMM-score: 8)
    Phage_holin_6_1; Bacteriophage holin of superfamily 6 (Holin_LLH) (PF09682; HMM-score: 7.5)
    IT (CL0182) CitMHS; Citrate transporter (PF03600; HMM-score: 7.3)
    no clan defined LapA_dom; Lipopolysaccharide assembly protein A domain (PF06305; HMM-score: 7.1)
    Halogen_Hydrol; 5-bromo-4-chloroindolyl phosphate hydrolysis protein (PF10112; HMM-score: 7)
    DUF2207; Predicted membrane protein (DUF2207) (PF09972; HMM-score: 6.6)
    Tetraspannin (CL0347) DUF4064; Protein of unknown function (DUF4064) (PF13273; HMM-score: 6.5)
    no clan defined IncA; IncA protein (PF04156; HMM-score: 6.4)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.32
    • Cytoplasmic Membrane Score: 9.55
    • Cellwall Score: 0.12
    • Extracellular Score: 0.01
    • Internal Helices: 2
  • LocateP: Multi-transmembrane
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular possibility: 0.17
    • Signal peptide possibility: -0.5
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.001472
    • TAT(Tat/SPI): 0.000247
    • LIPO(Sec/SPII): 0.052589
  • predicted transmembrane helices (TMHMM): 2

⊟Accession numbers[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MNISNENTVTLIAVIIAIIIGIFLQIFFKLPLIVTAVLSILLGIFVGFIVYLIVSFYNKRKN

⊟Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator:

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

⊟Literature[edit | edit source]

⊟References[edit | edit source]

  1. ↑ Ulrike Mäder, Pierre Nicolas, Maren Depke, Jan Pané-Farré, Michel Debarbouille, Magdalena M van der Kooi-Pol, Cyprien Guérin, Sandra Dérozier, Aurelia Hiron, Hanne Jarmer, Aurélie Leduc, Stephan Michalik, Ewoud Reilman, Marc Schaffer, Frank Schmidt, Philippe Bessières, Philippe Noirot, Michael Hecker, Tarek Msadek, Uwe Völker, Jan Maarten van Dijl
    Staphylococcus aureus Transcriptome Architecture: From Laboratory to Infection-Mimicking Conditions.
    PLoS Genet: 2016, 12(4);e1005962
    [PubMed:27035918] [WorldCat.org] [DOI] (I e)

⊟Relevant publications[edit | edit source]

Retrieved from "http://aureowiki.med.uni-greifswald.de/index.php?title=SAOUHSC_01315&oldid=100331"