From AureoWiki
Jump to: navigation, search
NCBI: 06-JUL-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_0885 [new locus tag: NWMN_RS04955 ]
  • pan locus tag?: SAUPAN003192000
  • symbol: NWMN_0885
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_0885 [new locus tag: NWMN_RS04955 ]
  • symbol: NWMN_0885
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 981869..982378
  • length: 510
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    ATGATTTTAGGATTAGCATTAATTCCATCAAAGTCATTTCAAGAAGCGGTGGATTCTTAC
    CGTAAAAGATATGATAAACAGTATTCACGAATTAAACCACATGTGACAATTAAAGCGCCA
    TTTGAAATTAAAGATGGTGATTTAGATTCTGTCATTGAACAGGTTAGAGCTCGTATTAAT
    GGTATACCAGCAGTAGAAGTTCATGCTACAAAAGCTTCTAGCTTCAAACCAACGAACAAT
    GTGATTTACTTTAAAGTTGCGAAGACGGACGACTTAGAAGAATTGTTTAATCGCTTTAAT
    GGAGAAGATTTCTATGGAGAAGCTGAACATGTTTTTGTGCCACACTTTACAATAGCACAA
    GGACTATCTAGCCAAGAATTCGAAGATATTTTTGGTCAAGTAGCATTAGCTGGGGTAGAC
    CATAAAGAAATTATCGATGAATTAACTTTGTTACGTTTTGACGATGACGAAGATAAATGG
    AAAGTTATTGAAACGTTTAAATTAGCTTAA
    60
    120
    180
    240
    300
    360
    420
    480
    510

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_0885 [new locus tag: NWMN_RS04955 ]
  • symbol: NWMN_0885
  • description: hypothetical protein
  • length: 169
  • theoretical pI: 4.81578
  • theoretical MW: 19325.7
  • GRAVY: -0.313609

Function[edit source | edit]

  • reaction:
    EC 3.1.-.-?  ExPASy
  • TIGRFAM:
    Genetic information processingTranscriptionRNA processing2'-5' RNA ligase (TIGR02258; EC 6.5.1.-; HMM-score: 15.8)
    putative phosphonate metabolism protein (TIGR03223; HMM-score: 12.5)
  • TheSEED:  
    RNA MetabolismRNA processing and modificationRNA processing orphans 2H phosphoesterase superfamily protein Bsu1186 (yjcG) 
  • PFAM:
    2H (CL0247) 2_5_RNA_ligase2; 2'-5' RNA ligase superfamily (PF13563; HMM-score: 71)
    LigT_PEase; LigT like Phosphoesterase (PF02834; HMM-score: 44.2)
    CPDase; Cyclic phosphodiesterase-like protein (PF07823; HMM-score: 17.8)
    no clan definedVps16_C; Vps16, C-terminal region (PF04840; HMM-score: 12.2)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:
    NWMN_0741(gapA)glyceraldehyde 3-phosphate dehydrogenase 1  [1] (data from MRSA252)
    NWMN_0961(pdhC)branched-chain alpha-keto acid dehydrogenase subunit E2  [1] (data from MRSA252)
    NWMN_0962(pdhD)dihydrolipoamide dehydrogenase  [1] (data from MRSA252)
    NWMN_0959(phdA)pyruvate dehydrogenase E1 component, alpha subunit  [1] (data from MRSA252)
    NWMN_1592(pykA)pyruvate kinase  [1] (data from MRSA252)
    NWMN_0500(rplA)50S ribosomal protein L1  [1] (data from MRSA252)
    NWMN_1151(rplS)50S ribosomal protein L19  [1] (data from MRSA252)
    NWMN_2135(rpsE)30S ribosomal protein S5  [1] (data from MRSA252)
    NWMN_2143(rpsQ)30S ribosomal protein S17  [1] (data from MRSA252)
    NWMN_1325(sucB)dihydrolipoamide succinyltransferase  [1] (data from MRSA252)
    NWMN_0510(tufA)elongation factor Tu  [1] (data from MRSA252)
    NWMN_0776glycine cleavage system protein H  [1] (data from MRSA252)
    NWMN_2086alkaline shock protein 23  [1] (data from MRSA252)

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 0.83
    • Signal Peptide Possibility: -0.5
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.164
    • Ymax_pos: 22
    • Cmax: 0.164
    • Cmax_pos: 22
    • Smax: 0.232
    • Smax_pos: 14
    • Smean: 0.161
    • D: 0.163
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MILGLALIPSKSFQEAVDSYRKRYDKQYSRIKPHVTIKAPFEIKDGDLDSVIEQVRARINGIPAVEVHATKASSFKPTNNVIYFKVAKTDDLEELFNRFNGEDFYGEAEHVFVPHFTIAQGLSSQEFEDIFGQVALAGVDHKEIIDELTLLRFDDDEDKWKVIETFKLA

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator: CcpA
    CcpA (TF) important in Carbon catabolism  RegPrecise

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. 1.00 1.01 1.02 1.03 1.04 1.05 1.06 1.07 1.08 1.09 1.10 1.11 1.12

Relevant publications[edit source | edit]