From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003192000
  • symbol?:
  • description?: 2-5 RNA ligase

      descriptions from strain specific annotations:

    • 2-5 RNA ligase
    • 2',5' RNA ligase
    • 2H phosphoesterase superfamily protein Bsu1186(yjcG)
    • conserved protein YjcG
  • strand?: +
  • coordinates?: 3584655..3585164
  • synteny block?: BlockID0022790
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0969
    08BA02176:
    C248_1039
    11819-97:
    MS7_0970
    71193:
    ST398NM01_1010
    ECT-R 2:
    ECTR2_869
    ED133:
    SAOV_0960
    ED98:
    SAAV_0977
    HO 5096 0412:
    SAEMRSA15_08450
    JH1:
    SaurJH1_1032
    JH9:
    SaurJH9_1013
    JKD6008:
    SAA6008_00969
    JKD6159:
    SAA6159_00871
    LGA251:
    SARLGA251_09300
    M013:
    M013TW_0939
    MRSA252:
    SAR0985
    MSHR1132:
    SAMSHR1132_08620
    MSSA476:
    SAS0884
    Mu3:
    SAHV_1009
    Mu50:
    SAV1015
    MW2:
    MW0896
    RF122:
    SAB0881
    ST398:
    SAPIG1010
    T0131:
    SAT0131_01049
    TCH60:
    HMPREF0772_12219
    TW20:
    SATW20_10120
    USA300_TCH1516:
    USA300HOU_0973
    VC40:
    SAVC_04240

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MILGLALIPSKSFQEAVDSYRKRYDKQYSRIKPHVTIKAPFEIKDGDLDSVIEQVRARIN
    N315            MILGLALIPSKSFQEAVDSYRKRYDKQYSRIKPHVTIKAPFEIEDGDLDSVIEQVRARIN
    NCTC8325        MILGLALIPSKSFQEAVDSYRKRYDKQYSRIKPHVTIKAPFEIKDGDLDSVIEQVRARIN
    Newman          MILGLALIPSKSFQEAVDSYRKRYDKQYSRIKPHVTIKAPFEIKDGDLDSVIEQVRARIN
    USA300_FPR3757  MILGLALIPSKSFQEAVDSYRKRYDKQYSRIKPHVTIKAPFEIKDGDLDSVIEQVRARIN
                    *******************************************:****************

    COL             GIPAVEVHATKASSFKPTNNVIYFKVAKTDDLEELFNRFNGEDFYGEAEHVFVPHFTIAQ
    N315            GIPAVEVHATKASSFKPTNNVIYFKVAKTDDLEELFNRFNGEDFYGEAEHVFVPHFTIAQ
    NCTC8325        GIPAVEVHATKASSFKPTNNVIYFKVAKTDDLEELFNRFNGEDFYGEAEHVFVPHFTIAQ
    Newman          GIPAVEVHATKASSFKPTNNVIYFKVAKTDDLEELFNRFNGEDFYGEAEHVFVPHFTIAQ
    USA300_FPR3757  GIPAVEVHATKASSFKPTNNVIYFKVAKTDDLEELFNRFNGEDFYGEAEHVFVPHFTIAQ
                    ************************************************************

    COL             GLSSQEFEDIFGQVALAGVDHKEIIDELTLLRFDDDEDKWKVIETFKLA
    N315            GLSSQEFEDIFGQVALAGVDHKEIIDELTLLRFDDDEDKWKVIETFKLA
    NCTC8325        GLSSQEFEDIFGQVALAGVDHKEIIDELTLLRFDDDEDKWKVIETFKLA
    Newman          GLSSQEFEDIFGQVALAGVDHKEIIDELTLLRFDDDEDKWKVIETFKLA
    USA300_FPR3757  GLSSQEFEDIFGQVALAGVDHKEIIDELTLLRFDDDEDKWKVIETFKLA
                    *************************************************