From AureoWiki
Jump to: navigation, search
NCBI: 06-JUL-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_1108 [new locus tag: NWMN_RS06265 ]
  • pan locus tag?: SAUPAN003477000
  • symbol: NWMN_1108
  • pan gene symbol?:
  • synonym:
  • product: pseudouridylate synthase

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_1108 [new locus tag: NWMN_RS06265 ]
  • symbol: NWMN_1108
  • product: pseudouridylate synthase
  • replicon: chromosome
  • strand: +
  • coordinates: 1212242..1213159
  • length: 918
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    901
    ATGGAGACTTATGAATTTAACATTACAGATAAAGAACAAACAGGTATGCGTGTAGATAAG
    TTGCTGCCTGAATTAAATAATGATTGGTCTCGTAACCAGATACAAGATTGGATTAAAGCA
    GGTTTAGTCGTTGCAAACGATAAAGTTGTTAAATCTAATTATAAAGTGAAACTTAATGAT
    CATATAGTTGTCACTGAAAAAGAAGTGGTTGAAGCTGATATTCTACCTGAAAATTTAAAT
    TTAGATATTTATTATGAAGATGACGATGTTGCAGTTGTATATAAACCGAAAGGCATGGTA
    GTTCATCCATCACCAGGGCATTATACCAATACATTAGTTAATGGTTTAATGTATCAAATT
    AAAAATTTGTCAGGTATTAATGGAGAAATTCGTCCAGGTATTGTTCACCGTATAGATATG
    GATACTTCTGGTTTATTAATGGTTGCTAAAAATGATATTGCTCATCGTGGGCTTGTAGAA
    CAATTAATGGATAAATCTGTTAAAAGAAAATATATCGCTTTAGTTCACGGGAATATTCCT
    CATGATTACGGTACAATCGATGCGCCAATTGGTAGAAACAAAAATGATCGTCAATCTATG
    GCTGTTGTTGATGATGGTAAGGAAGCAGTGACACATTTTAACGTACTAGAACATTTTAAA
    GATTATACGCTTGTTGAATGTCAACTTGAAACAGGACGTACGCATCAAATCCGTGTTCAC
    ATGAAATATATTGGCTTCCCATTAGTTGGTGATCCAAAGTATGGACCGAAAAAGACATTG
    GATATTGGTGGTCAAGCTCTACATGCTGGACTTATTGGATTCGAACATCCAGTAACAGGT
    GAATATATTGAAAGACATGCTGAATTACCACAAGACTTTGAAGATTTATTAGATACAATT
    CGAAAAAGAGATGCATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    900
    918

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_1108 [new locus tag: NWMN_RS06265 ]
  • symbol: NWMN_1108
  • description: pseudouridylate synthase
  • length: 305
  • theoretical pI: 6.01351
  • theoretical MW: 34604.2
  • GRAVY: -0.456066

Function[edit source | edit]

  • reaction:
    EC 5.4.99.-?  ExPASy
    RNA uridine = RNA pseudouridine?
  • TIGRFAM:
    Genetic information processingProtein synthesistRNA and rRNA base modificationpseudouridine synthase, RluA family (TIGR00005; EC 5.4.99.-; HMM-score: 327.3)
    Genetic information processingProtein synthesistRNA and rRNA base modificationpseudouridine synthase Rlu family protein, TIGR01621 (TIGR01621; EC 5.4.99.-; HMM-score: 82.8)
    Genetic information processingProtein synthesistRNA and rRNA base modificationpseudouridine synthase (TIGR00093; EC 5.4.99.-; HMM-score: 24.1)
  • TheSEED:  
    Ribosome biogenesis bacterial Ribosomal large subunit pseudouridine synthase D (EC 5.4.99.23) 
  • PFAM:
    PseudoU_synth (CL0649) PseudoU_synth_2; RNA pseudouridylate synthase (PF00849; HMM-score: 122.4)
    S4 (CL0492) S4; S4 domain (PF01479; HMM-score: 37.8)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:
    NWMN_0745(eno)phosphopyruvate hydratase  [1] (data from MRSA252)
    NWMN_1096(ftsZ)cell division protein FtsZ  [1] (data from MRSA252)
    NWMN_1580(gapB)glyceraldehyde 3-phosphate dehydrogenase 2  [1] (data from MRSA252)
    NWMN_1937(groEL)chaperonin GroEL  [1] (data from MRSA252)
    NWMN_1178(infB)translation initiation factor IF-2  [1] (data from MRSA252)
    NWMN_0162(pflB)formate acetyltransferase  [1] (data from MRSA252)
    NWMN_0959(phdA)pyruvate dehydrogenase E1 component, alpha subunit  [1] (data from MRSA252)
    NWMN_1592(pykA)pyruvate kinase  [1] (data from MRSA252)
    NWMN_0500(rplA)50S ribosomal protein L1  [1] (data from MRSA252)
    NWMN_2152(rplC)50S ribosomal protein L3  [1] (data from MRSA252)
    NWMN_2137(rplF)50S ribosomal protein L6  [1] (data from MRSA252)
    NWMN_0501(rplJ)50S ribosomal protein L10  [1] (data from MRSA252)
    NWMN_2120(rplM)50S ribosomal protein L13  [1] (data from MRSA252)
    NWMN_1547(rpmA)50S ribosomal protein L27  [1] (data from MRSA252)
    NWMN_1573(rpmI)50S ribosomal protein L35  [1] (data from MRSA252)
    NWMN_1166(rpsB)30S ribosomal protein S2  [1] (data from MRSA252)
    NWMN_2135(rpsE)30S ribosomal protein S5  [1] (data from MRSA252)
    NWMN_2128(rpsM)30S ribosomal protein S13  [1] (data from MRSA252)
    NWMN_1182(rpsO)30S ribosomal protein S15  [1] (data from MRSA252)
    NWMN_2148(rpsS)30S ribosomal protein S19  [1] (data from MRSA252)
    NWMN_1325(sucB)dihydrolipoamide succinyltransferase  [1] (data from MRSA252)
    NWMN_1569(tig)trigger factor  [1] (data from MRSA252)
    NWMN_02495'-nucleotidase, lipoprotein e(P4) family protein  [1] (data from MRSA252)
    NWMN_0641hypothetical protein  [1] (data from MRSA252)
    NWMN_0811hypothetical protein  [1] (data from MRSA252)
    NWMN_1382DNA-binding protein HU  [1] (data from MRSA252)

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.096
    • Ymax_pos: 40
    • Cmax: 0.103
    • Cmax_pos: 31
    • Smax: 0.116
    • Smax_pos: 36
    • Smean: 0.081
    • D: 0.09
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • METYEFNITDKEQTGMRVDKLLPELNNDWSRNQIQDWIKAGLVVANDKVVKSNYKVKLNDHIVVTEKEVVEADILPENLNLDIYYEDDDVAVVYKPKGMVVHPSPGHYTNTLVNGLMYQIKNLSGINGEIRPGIVHRIDMDTSGLLMVAKNDIAHRGLVEQLMDKSVKRKYIALVHGNIPHDYGTIDAPIGRNKNDRQSMAVVDDGKEAVTHFNVLEHFKDYTLVECQLETGRTHQIRVHMKYIGFPLVGDPKYGPKKTLDIGGQALHAGLIGFEHPVTGEYIERHAELPQDFEDLLDTIRKRDA

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. 1.00 1.01 1.02 1.03 1.04 1.05 1.06 1.07 1.08 1.09 1.10 1.11 1.12 1.13 1.14 1.15 1.16 1.17 1.18 1.19 1.20 1.21 1.22 1.23 1.24 1.25

Relevant publications[edit source | edit]